KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_4465Help
Entry
Cbei_4465         CDS       T00547                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00010  Glycolysis / Gluconeogenesis
cbe00052  Galactose metabolism
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01120  Microbial metabolism in diverse environments
cbe01130  Biosynthesis of antibiotics
Module
cbe_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_4465
   00052 Galactose metabolism
    Cbei_4465
Enzymes [BR:cbe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Cbei_4465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim Pept_tRNA_hydro PAS
Motif
Other DBs
NCBI-ProteinID: ABR36574
JGI: Cbei4465
UniProt: A6M1U4
Position
5160082..5161137
Genome map
AA seq 351 aa AA seqDB search
MAIEKNVFGTMPDGKDVYIYTLTNSNKMKVEISTYGGTIVSSLVPNKDGKLIDVTLGYDN
LDDYLKGDKFFGALIGRFGNRIQYGKFILNDQEYTLAQNDGENHLHGGLKGFDKVVWDSK
IVEDSPNTLELSYFSPDGEEGYPGNLNVKVTYVLTEDNALEINYSATSDKDTVVNLTNHA
YFNLSGHSSGDVLNQKLMINADKFTVNDKYSIPTGEIKEVAGTPMDFRSLTPIGKNITSD
YEQIDFGKGYDHNWVLNTDGCDSSKAAQAVDENSGIVLDVYTTTPGIQFYSGNFLDGSDV
GKNKSVYNRRNGFCLETQYFPNSINCSKFKSPILRAGEVYKDKTIYKFSTL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagaaaaaaatgttttcggaacaatgcctgatggaaaagatgtttatatttat
actttaacaaactctaacaaaatgaaagttgagatttctacttacggtggtacaatagtt
tcatctttagttccgaataaggatggtaaattaattgatgtaacgctaggatatgataat
ttagatgattatttaaaaggagataaatttttcggtgccttaataggacgttttggaaat
agaattcaatatggaaagttcatccttaatgatcaagaatatactttagctcagaatgat
ggggaaaatcatttacacggcggcttaaaaggctttgataaagtagtatgggattcaaaa
atagttgaagattctcctaatacattagagctttcttattttagcccagatggtgaagag
ggatatcctggtaaccttaatgttaaagttacttatgtgcttactgaagataatgctcta
gagataaattatagtgcaacttctgataaagatacagtcgtaaatcttacaaatcatgct
tattttaatttatctggtcattcatctggtgacgttcttaatcaaaaattgatgataaat
gcagataagtttacagtaaatgataaatattcaattcctacaggcgaaataaaagaggta
gccggaactcctatggactttagatcattaactcctatcggcaaaaatataactagtgat
tatgaacaaattgattttggaaaaggatacgatcataactgggtactaaataccgatgga
tgtgatagctcaaaagctgctcaagctgttgatgaaaattctggaatagtattggatgtt
tatacaaccactcctggaattcaattttacagcgggaactttcttgatggttcagatgta
ggtaaaaataaatctgtttataatcgtagaaatggattttgtttagaaactcaatatttt
cctaactctataaactgtagtaaatttaaatctccaatacttagagctggagaagtatat
aaagataaaaccatttataaattctctacattataa

DBGET integrated database retrieval system