KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_4643Help
Entry
Cbei_4643         CDS       T00547                                 

Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_4643
Enzymes [BR:cbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Cbei_4643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5378060..5379472)
Genome map
AA seq 470 aa AA seqDB search
MFHKKLKDFPKNFLWGASTSAYQVEGAYNEDGKGLSVQDTKEPFPGTPDFKVSSDHYHHY
KEDVALFAEMGFKTYRFSIAWTRIIPNGVGDVNPKGIEFYNNLINELLSHGIEPLVTMYH
FDLPDALQREGSWSNRKTADAFVNYAKVLFENFGDRVKYWLTINEQNMMILHGGAIGTVN
DGVENIEKELYKQNHHMMIAQAQTMKLCHSMCPKAKIGPAPNISSIYPASSRPEDILAAS
NQSSIRNWLYLDMAVHGRYNPIAWSYMVEKGIEPTIEDGDMEILKGGNPDFIAFNYYCTG
TAEESKIEDKEVSTQGGDQQIAVGDLGVYKGASNPNLEKTQFGWEIDPIGFRNTLREVYE
RYNLPIIITENGLGAYDDVEENDTINDDYRIDYLRKHIEQARLAITDGVDLIGYCPWSAI
DLISTHQGFKKRYGFIYVNRDEFDLKDLRRIRKKSFFWYKKVIETNGEEI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtttcataagaaattaaaagatttcccaaagaattttttatggggagcttcaacatca
gcttatcaagtagaaggtgcttataatgaagatggaaagggattatccgttcaagataca
aaagaaccattcccaggaacaccagattttaaggtgtctagtgaccactatcatcattac
aaagaagatgtagcattatttgcagaaatgggatttaagacttatcgtttttcaattgca
tggactagaataataccaaatggagtaggcgatgtaaatcctaagggaattgaattttat
aacaatttaatcaatgaactattatcacacggaatagaaccgttagttactatgtatcat
tttgatttgccagatgctcttcaaagagaaggtagttggtcaaatagaaagactgctgat
gcatttgtaaattatgcaaaagtattgtttgaaaatttcggtgatagagttaagtattgg
cttacaataaatgagcagaatatgatgatacttcatggaggggcaattggaactgtaaat
gatggagtagaaaatattgaaaaagaattatataaacaaaatcatcatatgatgattgca
caagcgcaaacaatgaagttatgccatagtatgtgcccaaaagcaaaaatagggcctgca
cctaatataagttcaatatatccagcaagttcaagaccagaagatatattagcggctagt
aaccaatcatctataaggaattggttatacttagatatggctgtacatggtagatataat
ccaatagcttggagctatatggttgaaaaaggaatcgagccaactattgaagatggagat
atggaaatattaaaaggtggaaatccagatttcatagcatttaattattattgtacagga
acagcagaggaaagtaagattgaagacaaagaagtttcgactcaaggtggagatcaacaa
attgctgtaggagatctaggtgtttacaaaggagcttctaatccgaacttggaaaaaact
caatttggatgggagattgatcctataggatttagaaatactttaagggaagtttatgaa
agatataatttacctataataatcactgaaaatggattaggtgcttatgatgatgttgaa
gaaaatgatactataaatgatgattatagaattgattatttaagaaaacatatcgaacag
gctagacttgctataactgatggagtagatttgattggatattgtccatggtcagctata
gatcttataagtactcaccaaggtttcaagaaaagatatggctttatatatgtaaataga
gatgaatttgatcttaaggatttaagaagaataagaaagaagagtttcttctggtataaa
aaagtcatcgaaactaatggagaagaaatttag

DBGET integrated database retrieval system