KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_4852Help
Entry
Cbei_4852         CDS       T00547                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cbei_4852
   01230 Biosynthesis of amino acids
    Cbei_4852
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_4852
   00030 Pentose phosphate pathway
    Cbei_4852
   00051 Fructose and mannose metabolism
    Cbei_4852
   00052 Galactose metabolism
    Cbei_4852
  Energy metabolism
   00680 Methane metabolism
    Cbei_4852
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cbei_4852
Enzymes [BR:cbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cbei_4852
Protein phosphatases and associated proteins [BR:cbe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cbei_4852
Messenger RNA biogenesis [BR:cbe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Cbei_4852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5679155..5680111)
Genome map
AA seq 318 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRTALHNGIEVMGVQRGYSGLINGELFSMDRNSVSDI
IQRGGTILRTARCPEFKNEEVRKKAAKILQAYGVEALVVIGGDGSFMGAKLLSKLGIKTI
GLPGTIDNDLAYTDFTLGFDTALNTVVDAINKIRDTSTSHERVSIVEVMGRDCGDLSLYA
GICGGAEAIIIPEMEFDKDALCRTILEGKNKGKMHNLIMLAEGIGGAFELAKYVEEVTGI
ETRATILGHIQRGGSPTATDRVLASRMGAKAIEVLLKGGTSRVIGIRDNKIIDQDIDEAL
DMESKFDKELYDIAQVLS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagctgtgttaacaagtggtggagatgcaccaggcatgaatgctgcaatt
agagcagtagtaagaactgcgcttcataacggaattgaagttatgggagtacaaagaggt
tatagtggacttattaatggagaattattcagcatggatagaaattcagtatctgatata
atccaaagaggtggaacaattttaagaactgctagatgtcctgaattcaagaatgaagaa
gtaagaaaaaaggctgcaaaaatattacaagcttatggtgttgaagctctagtagttata
ggtggagacggttcatttatgggtgcaaaattattatcaaagcttggaattaaaacaata
ggtttaccaggaacaattgataatgatttagcttacacagacttcactttagggtttgat
acagccttaaataccgttgtagatgctataaataaaattagagatacttcaacttcacat
gaaagagtttcaattgtagaagttatgggtagagactgcggagatttatctttatatgca
ggtatctgcggaggcgcagaagcaattataattcctgaaatggaatttgataaagatgca
ctttgtagaactatcttagaaggtaaaaataaaggaaaaatgcataatctaataatgctt
gcagaaggaattggaggagcatttgaacttgcaaagtacgttgaagaagtaactggaatt
gaaacaagagcaacaatcttaggtcatattcaaagaggaggaagtcctactgctacagat
agagttttagcttcaagaatgggagcaaaggctatagaagtattattaaaaggtggaact
tcaagagtaataggaattagagataataaaataatagaccaagatatagatgaagctctt
gatatggaaagcaaatttgataaagaactttatgatattgctcaagtattatcataa

DBGET integrated database retrieval system