KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_4852Help
Entry
Cbei_4852         CDS       T00547                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00010  Glycolysis / Gluconeogenesis
cbe00030  Pentose phosphate pathway
cbe00051  Fructose and mannose metabolism
cbe00052  Galactose metabolism
cbe00680  Methane metabolism
cbe01100  Metabolic pathways
cbe01110  Biosynthesis of secondary metabolites
cbe01120  Microbial metabolism in diverse environments
cbe01130  Biosynthesis of antibiotics
cbe01200  Carbon metabolism
cbe01230  Biosynthesis of amino acids
cbe03018  RNA degradation
Module
cbe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbe_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbei_4852
   00030 Pentose phosphate pathway
    Cbei_4852
   00051 Fructose and mannose metabolism
    Cbei_4852
   00052 Galactose metabolism
    Cbei_4852
  Energy metabolism
   00680 Methane metabolism
    Cbei_4852
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cbei_4852
Enzymes [BR:cbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cbei_4852
Protein phosphatases and associated proteins [BR:cbe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cbei_4852
Messenger RNA biogenesis [BR:cbe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Cbei_4852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABR36958
JGI: Cbei4852
UniProt: A6M2X8
Position
complement(5679155..5680111)
Genome map
AA seq 318 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRTALHNGIEVMGVQRGYSGLINGELFSMDRNSVSDI
IQRGGTILRTARCPEFKNEEVRKKAAKILQAYGVEALVVIGGDGSFMGAKLLSKLGIKTI
GLPGTIDNDLAYTDFTLGFDTALNTVVDAINKIRDTSTSHERVSIVEVMGRDCGDLSLYA
GICGGAEAIIIPEMEFDKDALCRTILEGKNKGKMHNLIMLAEGIGGAFELAKYVEEVTGI
ETRATILGHIQRGGSPTATDRVLASRMGAKAIEVLLKGGTSRVIGIRDNKIIDQDIDEAL
DMESKFDKELYDIAQVLS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagctgtgttaacaagtggtggagatgcaccaggcatgaatgctgcaatt
agagcagtagtaagaactgcgcttcataacggaattgaagttatgggagtacaaagaggt
tatagtggacttattaatggagaattattcagcatggatagaaattcagtatctgatata
atccaaagaggtggaacaattttaagaactgctagatgtcctgaattcaagaatgaagaa
gtaagaaaaaaggctgcaaaaatattacaagcttatggtgttgaagctctagtagttata
ggtggagacggttcatttatgggtgcaaaattattatcaaagcttggaattaaaacaata
ggtttaccaggaacaattgataatgatttagcttacacagacttcactttagggtttgat
acagccttaaataccgttgtagatgctataaataaaattagagatacttcaacttcacat
gaaagagtttcaattgtagaagttatgggtagagactgcggagatttatctttatatgca
ggtatctgcggaggcgcagaagcaattataattcctgaaatggaatttgataaagatgca
ctttgtagaactatcttagaaggtaaaaataaaggaaaaatgcataatctaataatgctt
gcagaaggaattggaggagcatttgaacttgcaaagtacgttgaagaagtaactggaatt
gaaacaagagcaacaatcttaggtcatattcaaagaggaggaagtcctactgctacagat
agagttttagcttcaagaatgggagcaaaggctatagaagtattattaaaaggtggaact
tcaagagtaataggaattagagataataaaataatagaccaagatatagatgaagctctt
gatatggaaagcaaatttgataaagaactttatgatattgctcaagtattatcataa

DBGET integrated database retrieval system