KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_4949Help
Entry
Cbei_4949         CDS       T00547                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cbei_4949
DNA repair and recombination proteins [BR:cbe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Cbei_4949
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cbei_4949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 PHF5 Cdd1 HHH_8 HHH DZR
Motif
Other DBs
NCBI-ProteinID: ABR37055
JGI: Cbei4949
UniProt: A6M375
Position
complement(5823759..5824358)
Genome map
AA seq 199 aa AA seqDB search
MMEFYPVAIEKLIEEFAKLPSIGQKTAQRLTLHILNLPDDEVKEFADALVKAKGTVKYCS
VCGNFTDKDPCALCGNPNRDKGTICVVEQPKDIMTMEKVKEYNGVYHVLHGNISPMQGRG
PQDIRIRELVSRMNEDVKEVILATNPNIEGEATAMYISKILKPLDVKVTRIASGIPVGGD
LDYADEVTLSKALEGRKEI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatggagttttatccagtagccatagaaaagttgatagaagaatttgccaagctacca
agtattggacaaaagacggctcaaagattaacattacatatattaaatcttccggatgat
gaagttaaggaatttgcggatgcattagttaaggcaaaaggaacggttaagtattgctcg
gtatgtggaaactttacagataaagatccttgtgcattatgtgggaatcctaatagagat
aagggtacaatatgtgttgtagagcagccaaaggatattatgacaatggaaaaggttaaa
gaatacaatggagtatatcatgtattacatggaaatatatctccaatgcaaggaagaggt
cctcaagatataagaattagagagcttgtttctagaatgaacgaagatgtaaaggaagta
atattagcaacgaatcctaatatagaaggagaggcaactgcaatgtacatatctaagata
cttaaacctcttgatgttaaagttactaggattgcttcaggtatacctgttggtggtgat
ttagattatgcagatgaagttacattatctaaggcactagagggaagaaaagagatataa

DBGET integrated database retrieval system