KEGG   Clostridium beijerinckii: Cbei_4953Help
Entry
Cbei_4953         CDS       T00547                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cbe  Clostridium beijerinckii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cbei_4953
   00670 One carbon pool by folate
    Cbei_4953
Enzymes [BR:cbe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Cbei_4953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5827699..5828190
Genome map
AA seq 163 aa AA seqDB search
MISIIVAIAKDNVIGKDNKLLWHISEDLKRFKKITTGKKMIMGRKTFESLPGILPNREHI
VLTRDNNFNVDSDKVTIEHDFNSVLQRYSECEDEVFVIGGAEIYKQFLPYAKKLYLTKVD
EEFEGDTYFPGINYSNYNTEYTSEKFIDEKNGLHYTFVNLIQA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaataattgttgctattgctaaagataatgtaatcgggaaagataacaaatta
ttatggcatatttcagaggatttaaagagatttaaaaaaataactacaggcaaaaaaatg
attatgggtagaaaaacttttgaatcattgcctggaattttaccaaatagagaacatata
gttctaactagagataataattttaatgtagattcagataaggtgacaatagagcacgat
tttaattcagtacttcaaagatattcggagtgtgaagatgaagtctttgtaattggaggt
gctgaaatttataaacaatttctcccttatgcaaagaaattatacttaacaaaagtagat
gaagaatttgaaggcgatacatatttccctggaattaattattcaaattataatactgaa
tacacatcagagaaatttattgatgaaaagaatggattgcattatacttttgtaaattta
atacaggcataa

DBGET integrated database retrieval system