KEGG   Clostridium botulinum F Langeland: CLI_0176Help
Entry
CLI_0176          CDS       T00563                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cbf00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
153233..154075
Genome map
AA seq 280 aa AA seqDB search
MLSKAHAKINLSLDVIGKRKDGYHLLKMLMQTIDLYDLIEIKKIKKDIIIDCDREYIPKD
RRNLAYKAASLFLDRYNIDSGVRINITKNIPVAAGLAGGSTDAATVLKIMRDIFEPDISN
EELKEIALDIGADVPFCIEGGTALCEGIGEKITSIKNFKNQILVLVKPNFGLSTKDVYNN
LKVEKIYIHPNTTKLIQSIEEDNLESVARNMRNVLENVTLRKYKTLNSIKSNFIELGALG
SMMSGSGPSVFGLFDDMLKAQICYDNMKEKYKEVFITRTI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaaaagctcatgctaaaataaatttatccttagatgtaataggaaaaagaaaa
gacggatatcaccttttaaagatgttaatgcaaaccatagatttatatgatttaatagaa
ataaaaaaaataaaaaaagatataataatagattgtgatagagagtatatacctaaagat
aggagaaatttagcatataaagcagcaagcctatttttagatagatacaatatagattca
ggagttagaataaacataactaaaaatataccagtagcagcaggattagcagggggaagc
acagatgcggctacggtattgaaaataatgagagatatatttgagccagacataagtaat
gaagaattaaaagagatagctttagatattggggcagatgtgccgttttgtatagaaggt
gggacagctctttgtgaaggtataggagaaaaaattacttccataaaaaattttaaaaat
caaatattagtattagttaaacctaattttgggttatctacaaaagatgtatacaataat
ttaaaagtagaaaaaatatatattcatcctaatacaacaaaattaatacaatcaatagaa
gaagataatttggaatctgtagctagaaatatgaggaatgtcttggaaaacgttacatta
agaaaatacaagacattaaattctataaaaagtaattttatagaattaggagcattagga
agtatgatgagtggtagcggaccaagtgtatttggattatttgatgacatgctaaaggct
caaatatgttatgataatatgaaagaaaagtataaagaagtatttataacaagaacaata
taa

DBGET integrated database retrieval system