KEGG   Clostridium botulinum F Langeland: CLI_0176Help
Entry
CLI_0176          CDS       T00563                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLI_0176 (ipk)
Enzymes [BR:cbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CLI_0176 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
153233..154075
Genome map
AA seq 280 aa AA seqDB search
MLSKAHAKINLSLDVIGKRKDGYHLLKMLMQTIDLYDLIEIKKIKKDIIIDCDREYIPKD
RRNLAYKAASLFLDRYNIDSGVRINITKNIPVAAGLAGGSTDAATVLKIMRDIFEPDISN
EELKEIALDIGADVPFCIEGGTALCEGIGEKITSIKNFKNQILVLVKPNFGLSTKDVYNN
LKVEKIYIHPNTTKLIQSIEEDNLESVARNMRNVLENVTLRKYKTLNSIKSNFIELGALG
SMMSGSGPSVFGLFDDMLKAQICYDNMKEKYKEVFITRTI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaaaagctcatgctaaaataaatttatccttagatgtaataggaaaaagaaaa
gacggatatcaccttttaaagatgttaatgcaaaccatagatttatatgatttaatagaa
ataaaaaaaataaaaaaagatataataatagattgtgatagagagtatatacctaaagat
aggagaaatttagcatataaagcagcaagcctatttttagatagatacaatatagattca
ggagttagaataaacataactaaaaatataccagtagcagcaggattagcagggggaagc
acagatgcggctacggtattgaaaataatgagagatatatttgagccagacataagtaat
gaagaattaaaagagatagctttagatattggggcagatgtgccgttttgtatagaaggt
gggacagctctttgtgaaggtataggagaaaaaattacttccataaaaaattttaaaaat
caaatattagtattagttaaacctaattttgggttatctacaaaagatgtatacaataat
ttaaaagtagaaaaaatatatattcatcctaatacaacaaaattaatacaatcaatagaa
gaagataatttggaatctgtagctagaaatatgaggaatgtcttggaaaacgttacatta
agaaaatacaagacattaaattctataaaaagtaattttatagaattaggagcattagga
agtatgatgagtggtagcggaccaagtgtatttggattatttgatgacatgctaaaggct
caaatatgttatgataatatgaaagaaaagtataaagaagtatttataacaagaacaata
taa

DBGET integrated database retrieval system