KEGG   Clostridium botulinum F Langeland: CLI_0232Help
Entry
CLI_0232          CDS       T00563                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cbf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
197193..199427
Genome map
AA seq 744 aa AA seqDB search
MQEIQGFIEDILFKNDENGYVVAKIRKKKELITIVGCMPYITEGQNLKLKGEWVIHPQFG
NQFKVEICEEIVPDTVAGIERYLSSGIISGIGPVTAKKIVKKFGEETLNILDNNIERLTE
IEGIGKKKIEIIYDSYIKQNEVRNIMMFFQNYGVTPNQCMKVYKRFGENSISIVKENPYI
LTEEIRGIGFKTADKIARSLGIASNSPFRIQSGINYIINGFCSLGNTYMPLEKLISEAMD
ILGVREEEIHENIYNNVAENKLKIEKVKEESCVFTLPYYYCELGVTKKILSLSLSQYDNL
NINIEDEVVSFEKNNNIKFHDSQREAIKGALENGVEIITGGPGTGKTTIINCITEIFEKA
NMKVYMAAPTGRAAKRMSETTGREAKTIHRMLEMGVSEDDTEEVFSKGEETPLECDVVII
DEASMIDIILMNTLLKAIALGTRIIIVGDVDQLPSVGPGNVLRDLIESKCVKVVRLKEIF
RQSKESMIIVNAHRINDGEMPIINKKDKDFYFIECSEPKKIVNTLLELSNRRLPKFNKSW
HKIHDIQILSPMRKGVLGVSSLNKELQSVLNPKNDSKKEMEFKDYIFRVGDKVMQTKNNY
SLKWTRASGEGEAEGLGIFNGDVGYIEDIDEEKETIQVLFDNERRVIYENLYLDEIDLAY
AVTIHKSQGSEFPVVIMPAFKGPPLLMNRNLLYTGITRAKRLVVLVGSLKAINFMVQNDK
IFERYSLLKWRISNILDTEIINGE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaatacagggatttatagaggatatactttttaaaaatgatgaaaatggatat
gtagtggcaaaaataagaaagaagaaagaacttataaccatagtcggatgtatgccctac
ataacagaaggacaaaacttaaaattaaaaggtgaatgggtaattcatccacaatttggt
aatcaattcaaagtagaaatatgtgaagaaatagtacccgatactgtagctggtatagaa
agatatttatcctcaggaatcatatcaggtataggcccagtgactgcaaaaaaaattgtg
aaaaaatttggagaagaaacattaaatatattagacaataatatagaaagattaacagag
atagagggaataggaaagaagaagatagaaataatatatgattcctatataaaacaaaat
gaagtgcgaaatataatgatgttttttcaaaattacggagttacacctaaccaatgcatg
aaagtttataaaagatttggagaaaattctatatcaatagttaaagagaatccatatata
cttacggaagaaataagaggaataggtttcaagacagcagataaaatagctaggagctta
ggaatagcctctaattcaccttttagaattcagagtggaataaattatataataaatgga
ttctgtagtttaggaaatacttatatgcctttagagaaacttataagtgaggctatggat
atattaggggtaagagaagaagaaatacatgaaaatatatataataatgtagcagaaaat
aaattaaagatagaaaaagtaaaagaggaaagttgtgtttttactctaccgtattattat
tgcgaattaggagttacaaaaaaaatacttagtttatctttgtcacaatatgataattta
aatataaatatagaagatgaggtagtgagttttgaaaaaaataataatataaaatttcat
gattctcaaagagaggctataaaaggtgccttagaaaatggagtagaaataataacagga
ggccctggtacaggaaaaacaactattattaattgtataacagagatatttgaaaaagct
aatatgaaagtttatatggcagcacctacaggaagagcggctaaaagaatgtctgaaact
acaggtagagaagctaaaacaatacataggatgttagaaatgggtgtatctgaggatgac
acagaagaagttttttctaaaggtgaagaaactcctttagaatgtgatgtagtaataata
gatgaagcttccatgatagatataatattaatgaatacactgttaaaggccatagcttta
ggtacaagaataataatagttggggatgtagatcaacttccttcagtaggtccagggaat
gtattaagagatttaatagaaagtaagtgtgtaaaggtagttagattaaaggagatattc
agacaatctaaagaaagtatgattatagtaaatgcccatagaataaatgatggagagatg
ccaattataaataaaaaagataaagatttttattttatagaatgtagtgaacctaaaaaa
atagttaatacattattagaactctcaaatagaagattgcctaaatttaataaaagttgg
cataaaattcatgatatacaaatactatctccaatgagaaagggagttctaggagtttct
agtttaaataaggaattacaatctgttttaaaccctaaaaatgattcaaaaaaagaaatg
gaatttaaagattatatatttagagtaggagataaagttatgcaaaccaaaaataactac
tctttaaagtggaccagagcaagtggtgagggggaagcagaagggttaggaatatttaat
ggagatgtaggatatatagaggatatagatgaggaaaaagaaacaattcaggtcttattt
gataatgaaagaagagtaatatatgaaaatttatatttagatgaaatagatttagcttat
gctgtaactattcataaaagtcaaggtagcgaatttccagtagtaattatgccagctttt
aaaggtcccccgcttttaatgaatagaaatttattgtatacaggaataacaagagcaaaa
aggcttgttgtcttggtaggatctttaaaagctattaattttatggtacagaatgataaa
atttttgaaagatactctcttttgaagtggcgtataagtaatattttagatactgaaatt
ataaatggagaataa

DBGET integrated database retrieval system