KEGG   Clostridium botulinum F Langeland: CLI_0293Help
Entry
CLI_0293          CDS       T00563                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLI_0293 (tpiA)
   01230 Biosynthesis of amino acids
    CLI_0293 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLI_0293 (tpiA)
   00051 Fructose and mannose metabolism
    CLI_0293 (tpiA)
   00562 Inositol phosphate metabolism
    CLI_0293 (tpiA)
Enzymes [BR:cbf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLI_0293 (tpiA)
Exosome [BR:cbf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLI_0293 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLI_0293 (tpiA)
  Exosomal proteins of melanoma cells
   CLI_0293 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
265312..266058
Genome map
AA seq 248 aa AA seqDB search
MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKV
GAQNMHFEESGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNL
IPIVCCGESLEEREGNITEKVLEGQIKVGLKELSKEQVEKLVIAYEPIWAIGTGKTATDE
QANETIGYIRTVVKDMYGENVADKVRIQYGGSVKPGTIKAQMAKEEIDGALVGGASLKAE
DFAAIINY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagccataatagcaggaaactggaaaatgaacaaaactgtaaaagaagcagta
gaactagttaaagaattaaaaccacttgttaaagatgcaaaatgtgatgtagttgtatgt
cctacttatgtatgccttccagcggtattagaagaagttaaaggaagtaatataaaagta
ggtgctcaaaatatgcactttgaagaaagtggagcttatacaggtgaaatagcacctaaa
atgttagaagaactaggagttcattatgtaattataggacatagtgaaagaagacaatac
tttaatgaaacagatgaaactgtaaacaaaaaagtaaaaaaagcctttgaacataattta
attccaatagtttgttgtggagaaagcttagaagaaagagaaggaaacataacagaaaaa
gttttagaaggacaaataaaagttggattaaaagaattaagcaaagaacaagtagaaaaa
ttagttatagcatatgaaccaatttgggctataggaacaggaaaaactgctacagatgaa
caagcaaatgaaactataggatatataagaactgtagtaaaagatatgtatggtgagaat
gttgcagataaagtaaggattcaatacggtggatctgttaagcctggcactatcaaagct
caaatggctaaagaagagattgatggtgcattagtagggggcgcaagcttaaaagcagaa
gattttgctgctataataaattattaa

DBGET integrated database retrieval system