KEGG   Clostridium botulinum F Langeland: CLI_0293Help
Entry
CLI_0293          CDS       T00563                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00010  Glycolysis / Gluconeogenesis
cbf00051  Fructose and mannose metabolism
cbf00562  Inositol phosphate metabolism
cbf01100  Metabolic pathways
cbf01110  Biosynthesis of secondary metabolites
cbf01120  Microbial metabolism in diverse environments
cbf01130  Biosynthesis of antibiotics
cbf01200  Carbon metabolism
cbf01230  Biosynthesis of amino acids
Module
cbf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLI_0293 (tpiA)
   00051 Fructose and mannose metabolism
    CLI_0293 (tpiA)
   00562 Inositol phosphate metabolism
    CLI_0293 (tpiA)
Enzymes [BR:cbf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLI_0293 (tpiA)
Exosome [BR:cbf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLI_0293 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLI_0293 (tpiA)
  Exosomal proteins of melanoma cells
   CLI_0293 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABS40011
UniProt: A7G9Y1
Position
265312..266058
Genome map
AA seq 248 aa AA seqDB search
MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKV
GAQNMHFEESGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNL
IPIVCCGESLEEREGNITEKVLEGQIKVGLKELSKEQVEKLVIAYEPIWAIGTGKTATDE
QANETIGYIRTVVKDMYGENVADKVRIQYGGSVKPGTIKAQMAKEEIDGALVGGASLKAE
DFAAIINY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagccataatagcaggaaactggaaaatgaacaaaactgtaaaagaagcagta
gaactagttaaagaattaaaaccacttgttaaagatgcaaaatgtgatgtagttgtatgt
cctacttatgtatgccttccagcggtattagaagaagttaaaggaagtaatataaaagta
ggtgctcaaaatatgcactttgaagaaagtggagcttatacaggtgaaatagcacctaaa
atgttagaagaactaggagttcattatgtaattataggacatagtgaaagaagacaatac
tttaatgaaacagatgaaactgtaaacaaaaaagtaaaaaaagcctttgaacataattta
attccaatagtttgttgtggagaaagcttagaagaaagagaaggaaacataacagaaaaa
gttttagaaggacaaataaaagttggattaaaagaattaagcaaagaacaagtagaaaaa
ttagttatagcatatgaaccaatttgggctataggaacaggaaaaactgctacagatgaa
caagcaaatgaaactataggatatataagaactgtagtaaaagatatgtatggtgagaat
gttgcagataaagtaaggattcaatacggtggatctgttaagcctggcactatcaaagct
caaatggctaaagaagagattgatggtgcattagtagggggcgcaagcttaaaagcagaa
gattttgctgctataataaattattaa

DBGET integrated database retrieval system