KEGG   Clostridium botulinum F Langeland: CLI_0596Help
Entry
CLI_0596          CDS       T00563                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00010  Glycolysis / Gluconeogenesis
cbf00030  Pentose phosphate pathway
cbf00051  Fructose and mannose metabolism
cbf00680  Methane metabolism
cbf01100  Metabolic pathways
cbf01110  Biosynthesis of secondary metabolites
cbf01120  Microbial metabolism in diverse environments
cbf01130  Biosynthesis of antibiotics
cbf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLI_0596
   00030 Pentose phosphate pathway
    CLI_0596
   00051 Fructose and mannose metabolism
    CLI_0596
  Energy metabolism
   00680 Methane metabolism
    CLI_0596
Enzymes [BR:cbf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CLI_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ABS42215
UniProt: A7GAS1
Position
complement(620166..622172)
Genome map
AA seq 668 aa AA seqDB search
MTLYDENNLHIIKDNLRYLKLLSKQYPSISSASSEIINLQAILNLPKGTEHFISDVHGEY
ESFTHMLKNASGVIKRKIDDVFGTSLRECDKKNLATLIYYPEQKLDLIKKSEKNLEDWYK
ITLYRLIRLCQIVSSKYTRSKVRKSLPSDFAYIIEELLNEQGDRVDKQEYYNSIIETIID
IDRASEFIIAISNVIQRLVVDKLHIIGDIYDRGPGAEIIIEALSKHHSIDIQWGNHDIVW
MGAAAGCEACIANVIRISLRYANLSTLEDGYGINLLPLATFAMDFYKEDNCENFKPRTID
KNLNETDIKLLSKMHKAISIIQFKLEGKIIKRRPEFKMEERLLLDKINIKEGTLSLNEKI
YKLIDTNFPTLDKENPYELNERERDLVEKLTNSFINSEKLQRHIKFLYSNGSLYLKYNSN
LLYHGCIPLNEDGSLKEVTLCKETLKGKSLLDKLDRLAREAYFFKKDPESKLYGMDMMWY
LWCGSNSPLFGKKKMTTFERYFLDDKNTHKEEKNPYYKYRNDEKMCTMIFEEFELDADNS
HIINGHIPVKTKEGENPIKANGKLLVIDGGFCKAYQPQTGIAGYTLIYNSYGLLLTSHEP
FSSIHKAIVEGNDILSSTTILEHVSSRKRVLDTDSGEEIKKQIHDLEMLLVAYRKGLIKE
ENEANIRF
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgactttatatgatgagaacaacttacatataataaaagataatttaagatatttaaaa
ttattgtccaaacagtaccctagtatttcaagtgctagttcagaaattataaatcttcaa
gcaatattaaacctccctaagggaacagaacattttataagcgatgttcacggagagtat
gaatcttttactcatatgctaaaaaatgcatcaggagttattaaaagaaaaatagatgat
gtctttggaacctctttaagggaatgtgacaaaaaaaatttagctacactaatatactat
cctgaacaaaaattagatttaataaaaaaatccgaaaaaaacttagaagattggtacaaa
ataactttatatagattaataagactatgtcaaatagtttcttctaaatatactagatct
aaagttagaaaatctctaccttctgattttgcttatattattgaagaattattaaatgaa
caaggtgatagagtagataagcaagaatattacaacagtataattgaaactattatagat
attgatagggcttctgaatttataattgctatatcaaatgttattcaaagattagtagta
gataagcttcatataataggagatatctatgatagaggtcctggagctgaaattataatc
gaagctttaagtaagcatcattctatagatatacaatggggtaatcatgacattgtatgg
atgggagctgctgcgggatgtgaagcttgtattgccaatgtaataagaatatctcttcgt
tatgctaatttatccacattagaagatggatatggtataaatttattaccattagctact
tttgctatggatttttataaagaagataattgtgaaaattttaaacctagaactatagat
aaaaatttaaacgaaacagatattaaacttttatcaaaaatgcataaagctatatcaata
attcaatttaagttggaaggtaaaataatcaaaagaagacctgaatttaaaatggaagaa
agattattattagataaaataaatataaaagaaggtactttgagcctaaacgagaaaatt
tataaattaattgatactaactttcctacattagataaagaaaatccttatgaattaaat
gaacgagaacgagatttagtagaaaaacttacaaattcgtttattaatagtgaaaagtta
caaagacatataaagtttttgtatagtaatggaagtctttacctaaagtacaactctaat
ttactatatcatggttgtatacctttaaatgaggatggctccttaaaagaagtaactcta
tgcaaggaaaccttaaaaggtaaatcccttctagacaaactagatcgtttagcaagagaa
gcttacttttttaagaaagatccagaatcaaaactatatggtatggacatgatgtggtat
ttatggtgtggttctaattctcctttatttggtaaaaaaaagatgaccacctttgaaaga
tatttcttagatgataagaatacacataaagaagaaaaaaatccttattacaaatataga
aatgatgaaaaaatgtgcacaatgatatttgaagaatttgaactagatgctgataattcg
catataataaatggtcatattcctgtgaaaactaaagaaggcgaaaatcctataaaagct
aatggtaaactattagttatagatggtggtttttgtaaagcctatcagccacaaacgggt
attgcaggatatacattaatatataattcctatggattacttctaacctctcatgagcct
tttagttctatacacaaagctatagtagaaggaaatgatatactttcatctactacaata
ttagaacatgtatcctcacgaaaaagagtattagatacagatagtggtgaggagataaaa
aaacagatacatgatttagaaatgctattagttgcttacagaaaaggtcttataaaagaa
gaaaatgaagcaaatataagattttag

DBGET integrated database retrieval system