KEGG   Clostridium botulinum F Langeland: CLI_0963Help
Entry
CLI_0963          CDS       T00563                                 

Definition
glycosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbf00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1006156..1007577
Genome map
AA seq 473 aa AA seqDB search
MSGLAKDFLWGGATAANQCEGGYLEGNRGLGTVDVIPAGANRRAVMQGKMHYNNLQEDSY
FPSHEAIDMYHNYKEDIALFAEMGFKCYRFSFSWSRIFPTGKEQEPNEEGLAFYEKFIDE
LLKYNIEPVVTICHFDVPLVLEQEYGSWRSRKLIDAYLRYCEAIFKRFNGKVKYWITFNE
INMLMHLPFMGAGIMFKEGENELEVKYQAAHNELVASALATKLAKEINKDNKIGCMLAAG
QFYPYTCKPEDVLEAMEKDKNNYFFIDVQSRGEYPSYAKKFLERNNIKIEMQPEDEKILR
KNTVDFIAFSYYTSRLASSDPNAGEKSAGNVITSLKNPHLKSSKWGWQIDPIGLRITMNS
LYDRYQKPLFIVENGLGAVDVLSEDGTVDDDYRIAYLENHIKNMIDAVELDGVELLGYTT
WGCIDLVSASTGEMKKRYGFIYVDKDNDGHGTLKRYKKKSFYWYKNVIKNNRL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattagcaaaggattttttatggggcggagctacagcagctaaccaatgcgaa
ggtggttatttagaaggaaatagaggattaggaactgtggacgttattccagcaggagca
aatcgtagagctgttatgcaaggaaagatgcattataataatttacaagaggattcttat
ttcccatcacatgaagcaatagatatgtatcataactacaaggaagatatagcattattt
gcagaaatgggctttaaatgttatcgtttctcattttcatggtcaagaattttcccaaca
ggaaaggaacaagaaccaaatgaggaaggtttagcattttatgaaaaatttattgatgaa
ctattaaaatataatattgaaccagtagttactatatgtcactttgatgtacctcttgta
ttggagcaggaatatggttcatggagaagtagaaaattaatagatgcatatcttagatat
tgtgaagcaatatttaaaagatttaatggaaaagtaaagtattggataacttttaatgaa
ataaatatgcttatgcatttaccctttatgggagctggaataatgtttaaggaaggggaa
aatgagctagaagtaaaatatcaagcagctcataatgaattagtggcatcagctttagct
acaaaattagcaaaggaaattaataaagataataaaataggatgcatgttagcggcaggg
caattctatccatatacttgtaagccagaggatgttctagaggctatggagaaagataaa
aataattatttcttcatagatgtacaatctaggggagaatatccgagctatgctaaaaaa
tttttagagagaaacaatataaaaatagaaatgcagccagaagatgagaagattttaagg
aagaatactgttgattttattgcatttagttactatacttcaagacttgcaagtagtgac
ccgaatgcaggagaaaaatcagctggtaatgtaataacatcattaaaaaatccacattta
aaatctagtaaatggggatggcaaatagatccaataggtcttagaattacaatgaattca
ctttatgatcgttatcaaaaaccgctattcattgtggaaaatggcttaggtgctgttgat
gttttaagtgaagatggtactgtagatgatgattacagaattgcttatcttgaaaatcat
ataaaaaatatgattgatgcagttgaattagatggtgttgaactattaggatatacaact
tggggatgtattgatttggttagtgcatcaacaggggaaatgaagaagcgatatggtttt
atatatgtggataaggataatgatggtcatggaactttaaagagatacaagaaaaaatct
ttctattggtacaaaaatgttattaaaaataatagactataa

DBGET integrated database retrieval system