KEGG   Clostridium botulinum F Langeland: CLI_1008Help
Entry
CLI_1008          CDS       T00563                                 

Gene name
cobA_hemD
Definition
uroporphyrinogen III synthase/methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cbf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1055364..1056824
Genome map
AA seq 486 aa AA seqDB search
MSKVYLIGAGPGDEELITLKAIGALKKCTAVMYDRLANGELLKYLAPNCEIYYCGKEPGC
HYKSQDEINKMLVKLAKQGHIVGRIKGGDPYVFGRGGEEALDILEENIEFEVIPGVTSPV
SVLNYAGIPITHRGISRGFHIFTAMTKDKLDIDWKSVVNIGGTLVFLMGLGRLELITKGL
IENGMDKESKVAVVMKGTTSKQKKVIGNLENIVEKVKEAKLESPVIIVVGEVVSFSDKLN
WYEKKPLFGRNICITRTKEQAKELKVQLLDLGAEVTEINSIEIKNAEENLKPYLNRLKEY
DYIALTSVNAVKIFFDYLIKENIDIRNINAKFAAIGPATSEAIRMRGIMPSIKSKHFVAE
SLFEEMKNHIQKGDKILVPRSKDARPFLVDALRKEGCAVDEVHIYETLCGQCTYTERFEN
ADTVLFTSPSTVRNMISMVGIDSIKEKNIIAIGPITAAELDKNNIECSICDEYSINGIID
KLLALN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggtatatttaattggtgcagggccgggggatgaagaactaataactttaaaa
gctataggagccctaaaaaaatgtactgcagttatgtatgatagattagcaaatggagaa
ttgttaaaatatttagcaccaaattgtgaaatttattattgtggaaaagaaccgggctgt
cattataaaagccaggatgaaataaataaaatgctagttaaattagcaaaacaaggtcat
attgtaggaagaataaaaggtggagatccctatgtatttggaagagggggagaagaagcc
ttagatattttagaagaaaatatagaatttgaagttatacctggtgtaacttctccagta
tctgtattaaattatgcaggaattcctataacccatagaggaatatcaagagggtttcat
atttttacagctatgactaaggataaattagatatagattggaagtctgtagttaatata
ggaggaaccttagtatttttaatgggtcttggaagattagaattaataactaaaggtctt
atagaaaatggaatggacaaagaaagtaaagtagcagtagttatgaaaggaactacctca
aagcaaaaaaaggttataggtaacttagaaaatatagtagaaaaagtaaaagaagctaaa
ctagaatctccagtaataatagtagtaggagaagtagttagtttttcagataaattaaat
tggtatgaaaaaaagcccttgttcggaagaaatatatgcataacccgtacaaaagagcaa
gctaaggagttaaaagttcaacttttagatttaggggctgaagttacagaaataaattct
atagaaataaaaaatgcagaagagaacttaaagccttatttaaatagattaaaagaatat
gattatatagcattaaccagtgtaaatgcagttaaaatattttttgattatttaattaaa
gaaaatatagatattagaaatattaacgctaaatttgcagctataggaccagccactagt
gaggcaataaggatgagaggaataatgccaagcattaaatcaaagcattttgtagcagaa
agcctttttgaagaaatgaaaaatcatatacaaaagggagataaaatacttgtacctcgc
tcaaaagatgcaagaccctttcttgtggatgcattaagaaaagaaggttgcgctgtagat
gaagtacatatatatgaaaccttatgtggacaatgtacatacactgaaagatttgaaaat
gcagatacagtattatttacaagtccatctactgttagaaatatgatttccatggtgggg
atagatagtataaaagaaaaaaatattatagcaataggaccaatcacagcagcagaatta
gataaaaataatatagaatgcagcatttgtgatgaatattctataaatggcataatagat
aaacttttagcccttaactag

DBGET integrated database retrieval system