KEGG   Clostridium botulinum F Langeland: CLI_1008Help
Entry
CLI_1008          CDS       T00563                                 

Gene name
cobA_hemD
Definition
uroporphyrinogen III synthase/methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLI_1008 (cobA_hemD)
Enzymes [BR:cbf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CLI_1008 (cobA_hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CLI_1008 (cobA_hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1055364..1056824
Genome map
AA seq 486 aa AA seqDB search
MSKVYLIGAGPGDEELITLKAIGALKKCTAVMYDRLANGELLKYLAPNCEIYYCGKEPGC
HYKSQDEINKMLVKLAKQGHIVGRIKGGDPYVFGRGGEEALDILEENIEFEVIPGVTSPV
SVLNYAGIPITHRGISRGFHIFTAMTKDKLDIDWKSVVNIGGTLVFLMGLGRLELITKGL
IENGMDKESKVAVVMKGTTSKQKKVIGNLENIVEKVKEAKLESPVIIVVGEVVSFSDKLN
WYEKKPLFGRNICITRTKEQAKELKVQLLDLGAEVTEINSIEIKNAEENLKPYLNRLKEY
DYIALTSVNAVKIFFDYLIKENIDIRNINAKFAAIGPATSEAIRMRGIMPSIKSKHFVAE
SLFEEMKNHIQKGDKILVPRSKDARPFLVDALRKEGCAVDEVHIYETLCGQCTYTERFEN
ADTVLFTSPSTVRNMISMVGIDSIKEKNIIAIGPITAAELDKNNIECSICDEYSINGIID
KLLALN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggtatatttaattggtgcagggccgggggatgaagaactaataactttaaaa
gctataggagccctaaaaaaatgtactgcagttatgtatgatagattagcaaatggagaa
ttgttaaaatatttagcaccaaattgtgaaatttattattgtggaaaagaaccgggctgt
cattataaaagccaggatgaaataaataaaatgctagttaaattagcaaaacaaggtcat
attgtaggaagaataaaaggtggagatccctatgtatttggaagagggggagaagaagcc
ttagatattttagaagaaaatatagaatttgaagttatacctggtgtaacttctccagta
tctgtattaaattatgcaggaattcctataacccatagaggaatatcaagagggtttcat
atttttacagctatgactaaggataaattagatatagattggaagtctgtagttaatata
ggaggaaccttagtatttttaatgggtcttggaagattagaattaataactaaaggtctt
atagaaaatggaatggacaaagaaagtaaagtagcagtagttatgaaaggaactacctca
aagcaaaaaaaggttataggtaacttagaaaatatagtagaaaaagtaaaagaagctaaa
ctagaatctccagtaataatagtagtaggagaagtagttagtttttcagataaattaaat
tggtatgaaaaaaagcccttgttcggaagaaatatatgcataacccgtacaaaagagcaa
gctaaggagttaaaagttcaacttttagatttaggggctgaagttacagaaataaattct
atagaaataaaaaatgcagaagagaacttaaagccttatttaaatagattaaaagaatat
gattatatagcattaaccagtgtaaatgcagttaaaatattttttgattatttaattaaa
gaaaatatagatattagaaatattaacgctaaatttgcagctataggaccagccactagt
gaggcaataaggatgagaggaataatgccaagcattaaatcaaagcattttgtagcagaa
agcctttttgaagaaatgaaaaatcatatacaaaagggagataaaatacttgtacctcgc
tcaaaagatgcaagaccctttcttgtggatgcattaagaaaagaaggttgcgctgtagat
gaagtacatatatatgaaaccttatgtggacaatgtacatacactgaaagatttgaaaat
gcagatacagtattatttacaagtccatctactgttagaaatatgatttccatggtgggg
atagatagtataaaagaaaaaaatattatagcaataggaccaatcacagcagcagaatta
gataaaaataatatagaatgcagcatttgtgatgaatattctataaatggcataatagat
aaacttttagcccttaactag

DBGET integrated database retrieval system