KEGG   Clostridium botulinum F Langeland: CLI_1010Help
Entry
CLI_1010          CDS       T00563                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00860  Porphyrin and chlorophyll metabolism
cbf01100  Metabolic pathways
cbf01110  Biosynthesis of secondary metabolites
cbf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLI_1010 (hemB)
Enzymes [BR:cbf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CLI_1010 (hemB)
Exosome [BR:cbf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLI_1010 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD DNA_photolyase NTase_sub_bind
Motif
Other DBs
NCBI-ProteinID: ABS40778
UniProt: A7GBW6
Position
1057414..1058388
Genome map
AA seq 324 aa AA seqDB search
MFRRHRRLRENEAIRAMVRETVIREEDFIYPMFVVEGENIKEEISSLPGNYHYSIDRLEE
LVEEVKKSGIKGIMIFGVPDHKDECGSAAFDDNGIVQKGIRRLRELMPELYIVADVCMCQ
YTSHGHCGIIHGHNVDNDESLKYLAKISLSYAKAGADMIAPSDMMDGRVYAIRKILDENN
FKHVGIMAYSAKYCSAFYGPFREAANSAPQFGDRKTYQMDPANGREAMLEIEDDINEGAD
IVMVKPALPYLDVIRMAKDRFEFPLAAYNVSGEYAMVKAAAKQGLIDERRVALEMLTSIK
RAGADIIITYYAFEASAWLKEDRK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagacacagaagattaagagagaatgaagcaataagagctatggtaagagaa
acagtgattagagaagaggattttatatatccaatgtttgtggtagaaggagaaaatatt
aaagaagaaatatcttcactgccaggaaattatcattattctatagatagattagaagaa
ttagtagaagaagtaaagaaatcaggcataaaaggcataatgatatttggagtaccagat
cataaagatgaatgtggctctgcagcctttgatgataatggaatagttcaaaagggtata
agaagattaagagaattaatgccagaactatatatagttgcagatgtatgtatgtgccaa
tatacaagtcatgggcattgcggaataattcatggtcataatgtagataatgatgaatca
ttgaaatatttagcaaaaatatctttatcctatgcaaaagctggagcagatatgatagca
ccttcagatatgatggatggaagagtttatgctataagaaaaatattagatgaaaataat
tttaaacatgtaggcataatggcttatagtgcaaaatattgttcagctttctatggccct
ttcagagaagcagccaattcagcaccacaatttggagacagaaaaacttatcaaatggat
ccagcaaacggaagagaagcaatgcttgaaatagaagacgatataaatgaaggtgcagat
atagtaatggtaaagccagctttaccatacttagatgttataagaatggcaaaggataga
tttgaatttccgttagcagcttacaatgtaagtggagaatatgctatggtaaaagcagca
gctaaacaaggattaatagatgaaagaagagtagccctagaaatgctaacatcaataaaa
agagcaggagcagatataataataacttattatgcatttgaagcaagtgcttggttaaaa
gaagacagaaaatag

DBGET integrated database retrieval system