KEGG   Clostridium botulinum F Langeland: CLI_1646Help
Entry
CLI_1646          CDS       T00563                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLI_1646 (rbsK)
Enzymes [BR:cbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CLI_1646 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1744883..1745794
Genome map
AA seq 303 aa AA seqDB search
MDIAVIGSNMVDLISYIDRMPKEGETLEALDFKMGCGGKGANQAITAARLKSDVMMVSKV
GDDLFGQNTIKNFKNNGVNTDFVTVQKNQASGVAPIFVDKESKNSILIIKGANKNLSPTD
IDDASEELKKCSLIILQLEIELETVYYSIDFANKNNIPVLLNPAPATKELDFNYVYKCDF
FVPNETELEILTNKPVNTIEDIKEAAHFIEDKGVKNVIVTMGSKGLLWINKDEEHFIKAR
KVDAVDTTGAGDGFIGCFAHYYVATKNILLALEKATAYAALSVTRYGTQTSYPTKEEFEE
FLK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcagttattggttcaaatatggtagatttgataagctatattgatagaatg
cctaaagaaggtgagactttagaagcattagattttaaaatgggatgtgggggtaaggga
gcaaaccaggccattacagctgcaagattaaaatcagatgttatgatggtaagtaaagtt
ggagatgatttatttggacaaaacactattaaaaattttaaaaacaatggtgtaaataca
gattttgtaactgttcaaaaaaatcaagctagtggagttgcacctatttttgttgataaa
gaatctaaaaatagtattttaattattaaaggtgccaataaaaatttatctcctacagat
atagatgatgcaagtgaagaattgaaaaagtgttctttaattattttacaattggaaatt
gaattagaaactgtttattattctatagattttgctaataagaataatattcctgtattg
ttaaatcctgcgcctgctacaaaagaacttgatttcaattatgtttataaatgtgatttc
tttgtgccaaatgaaacagaattagagattttaacaaataaacctgtaaatacaatagaa
gatataaaagaagctgctcatttcattgaggataaaggggttaaaaatgtaattgttaca
atgggtagcaaaggtttactatggattaataaagatgaagagcattttataaaagcacgt
aaagttgatgctgtagacaccaccggtgctggtgatggatttattggatgttttgcacat
tattatgtagccacaaaaaacatattattagctcttgaaaaagcaacagcttatgcagca
cttagtgttacaagatatggtactcaaacttcttatcctacaaaggaggagtttgaagaa
tttttaaaataa

DBGET integrated database retrieval system