KEGG   Clostridium botulinum F Langeland: CLI_1649Help
Entry
CLI_1649          CDS       T00563                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbf01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cbf00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1748260..1749570
Genome map
AA seq 436 aa AA seqDB search
MINVVKIGEDNKKQCMNNLKSRSKKVQKDVITSVKKILGDINENGDKALIKYTNKFDSKK
INLENIRVTSEEIKKAYELVDEKFIKAIKIAKENILFYHEKQKQRSWMVTKEDGIILGQQ
IRALETVGIYVPGGTAAYPSSVLMNTLPAKVAGVEKIVMITPPSKDGSVNPNILVAANIA
GVDEIYKAGGAQGIGALAYGTKIIPKVDKIVGPGNIYVAMAKRSVYGFVDIDMIAGPSEI
LIIADESSDPKFIAADFMSQAEHDVLASSMLVTTSERLAQKVKDQLNIQIKNLSRKEIIR
TSIKDFGAIFVVDNLEEAIELANDISPEHLEVMTEDPFTILGQIKNAGSVFLGKYAPEPL
GDYMAGPNHVLPTSGSARFFSPLSVDDYIKKSSFTYYTKRALEKVKDVTVTIAETEGLTA
HANSIRVRFDNNNFSF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgtggttaaaataggtgaagacaataaaaaacagtgcatgaataatttgaaa
agcaggtcaaaaaaagtacaaaaagatgtaattacttctgtaaaaaaaatactaggggac
ataaatgaaaatggggataaagcattaataaaatatactaataagtttgatagtaaaaaa
ataaatttagaaaatattagagttacttcagaagagataaaaaaggcttatgaattagtt
gatgaaaaatttataaaggctataaaaattgctaaagaaaatatattgttttatcatgag
aagcaaaaacaaagatcatggatggtaacaaaggaagatggaataattttaggtcagcaa
attagagctctagagactgtaggtatatacgttccaggaggaacagcagcttatccttct
tcagtattaatgaacacccttccagctaaagtagcaggagtagaaaaaatagttatgata
actcctccttctaaggatgggagtgtaaatcctaatattttagtagctgctaatattgct
ggagttgatgaaatatataaagcaggaggagcacaaggaataggagctttagcttatgga
acaaaaatcataccaaaggtagataaaatagtaggtccaggtaatatatatgtggctatg
gccaaaagaagtgtttatggctttgtggatatagatatgatagcaggacctagtgaaatt
ttgattatagcagatgaaagttctgatcctaaatttatagcagcagattttatgtctcaa
gctgagcatgatgtattggcatcctcaatgttagttactacctctgagagattagcacaa
aaggtaaaagaccaattaaatatacagataaaaaatctttcaaggaaagaaataatacgt
acatctattaaagattttggtgctatttttgtagtagataatttagaagaagctatagaa
cttgctaatgatatatccccagaacatttagaggttatgacagaagaccccttcactatt
ttaggacaaattaaaaatgcaggttctgtattcttaggtaaatatgctccagaaccatta
ggggattatatggcaggaccaaatcatgtattgcctactagcggaagtgcaagatttttt
tcacctctttcagtagatgattatattaagaaatcaagtttcacatattacaccaaaagg
gcattggaaaaagtaaaggatgttactgtaaccattgctgaaacagagggattaactgcc
catgcaaattccataagagtgagatttgataacaataatttttcattttag

DBGET integrated database retrieval system