KEGG   Clostridium botulinum F Langeland: CLI_1683Help
Entry
CLI_1683          CDS       T00563                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLI_1683
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLI_1683
   00052 Galactose metabolism
    CLI_1683
   00500 Starch and sucrose metabolism
    CLI_1683
   00520 Amino sugar and nucleotide sugar metabolism
    CLI_1683
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLI_1683
   00524 Butirosin and neomycin biosynthesis
    CLI_1683
Enzymes [BR:cbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLI_1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1785571..1786518
Genome map
AA seq 315 aa AA seqDB search
MNKKYVVGVDLGGTKIYTALVDLDGNIIKEKKVKTEASKGELDVLSKIINTIDNVIEGVN
LEEIKAIGIGSPGPLDAKEGIIISSSNLPFENFSLVQPIKDKYNIPTYLDNDANVATLAE
FMFGEGKGTKNMIYVTASTGIGAGAIINSRIYRGNTGNALEIGHTTVMKDGPNCGCGNKG
CAESLGSGTAIMKKAKEVCRNNGETSLKEYDNLTAKEVFEEAKKGDKDSKEVLEFCLSYL
GITVANIINTFDPEMVVIGGGVINGGEIVCDIINREVKNRCWKAIRDNCKITKAKLAGKA
GVLGAAALAITESKN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaatatgtagtgggtgttgatttagggggaacaaagatttatacagcactt
gtggatttagatggaaatataataaaagaaaaaaaagttaaaactgaagcaagcaaggga
gaacttgatgtattatctaaaataataaatactattgataatgttatagaaggggtaaac
ttagaggaaataaaggctataggaataggttcaccaggacctttagatgctaaagaaggt
ataataatttcatcttcaaatctaccctttgaaaattttagcttagttcaacctataaag
gataaatataatattccaacatacctagacaatgatgctaatgtagctactctagctgaa
tttatgtttggtgaaggaaaaggtaccaagaacatgatatacgtaacagcaagtacaggc
attggagcaggagctataataaatagcagaatatatagaggaaatacaggaaatgcttta
gaaataggccatacaactgttatgaaagatgggccgaactgtggttgtggtaataagggt
tgtgcagaaagtttaggttctggtactgccattatgaaaaaggcaaaagaagtttgtaga
aataatggagagacgtctttaaaagaatatgataatctaactgcaaaggaagtttttgaa
gaagctaaaaaaggagataaggattcaaaggaagtactagaattttgcttatcctattta
ggtataactgtagccaatataataaatacctttgatccagaaatggttgttataggcgga
ggagttataaatggtggagaaattgtttgtgatataataaatagagaagtgaaaaataga
tgctggaaagctattagggataattgtaaaataacaaaagcaaagcttgcaggaaaagca
ggggttctaggagctgcagccttagctataactgaaagtaaaaattaa

DBGET integrated database retrieval system