KEGG   Clostridium botulinum F Langeland: CLI_1715Help
Entry
CLI_1715          CDS       T00563                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00260  Glycine, serine and threonine metabolism
cbf00750  Vitamin B6 metabolism
cbf01100  Metabolic pathways
cbf01110  Biosynthesis of secondary metabolites
cbf01120  Microbial metabolism in diverse environments
cbf01230  Biosynthesis of amino acids
Module
cbf_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLI_1715 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLI_1715 (thrC)
Enzymes [BR:cbf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLI_1715 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABS42869
UniProt: A7GDW5
Position
1828456..1829937
Genome map
AA seq 493 aa AA seqDB search
MFYKSTRGEGKNVKASEAIIRGIAEDGGLYVPEELPKIDKSFKELENMDYKELAFYIMKK
YFDDFNEEELKECIDRAYDSKFEDPLIAPLNYKAGAYFLELYHGKTLAFKDMALSILPHL
LKASAKKINITKDIVILTATSGDTGKAALEGFDSVEGTKIVVFYPKDGVSEIQKRQMVTQ
EGKNTFVVGIEGNFDDAQNGVKEIFNDKDFNELLEEKGCMFSSANSINIGRLVPQIVYYV
YSYVNLLKAKKVGEGESINIVVPTGNFGNILAAFYAKNMGIPVGKLICASNENKVLTDFI
NTGIYDRRRNFSVTNSPSMDILISSNLERFLYEISGRDSCLIENLMAELKEKGKYEITEE
MKKRLNILYGDFADEDDTLKAIEKVYENSDYLIDTHTAVAYRVYEKYKNKTGDNRVTIIA
STASPFKFPKSINEVLNIGHENASDFELINLFSDKLNLKLPKGLEGLEEKEICHKVTCKK
DEMKKVIKNFLGI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgttttataaaagtactagaggagaaggaaagaatgttaaagcatcagaggcaataatt
agaggaatagctgaggatggaggattatatgtaccagaagagcttcctaaaatagataag
agctttaaagaactagaaaacatggattataaagaattagcattttatattatgaaaaag
tactttgatgattttaatgaagaggaacttaaagaatgtatagatagagcctatgacagt
aagtttgaagatcctcttatagcgccattaaattataaagctggagcatattttttagaa
ctttatcatgggaaaacattagcctttaaagatatggccttaagcatacttccacacctt
ttaaaagcttcagcaaaaaagattaatataactaaagacatagttatattaacagctact
tcaggagatactggaaaagctgctttagaaggatttgatagtgtagagggcacaaagata
gtagtattttatcctaaggatggagtaagtgaaattcaaaaaagacaaatggttacacaa
gagggaaaaaatacttttgtagtaggcatagaggggaatttcgatgatgctcaaaatgga
gttaaggaaatatttaatgataaagattttaatgaattattagaggaaaagggatgcatg
ttttcctctgctaattctataaatataggaagattggtaccgcaaatagtatattatgtt
tattcttatgtaaacctacttaaagccaaaaaagtaggggaaggagaaagtataaacata
gttgttcctacaggaaattttggtaacattttagcagccttttatgctaaaaatatggga
ataccagtgggaaaattaatttgtgcatctaatgagaataaggtgctaacagactttata
aatactggaatatacgataggagaagaaacttttctgttactaattctccttccatggat
attttaatatctagtaacttggaaagatttttgtatgaaataagtgggagagattcatgt
cttatagaaaatcttatggcagaacttaaagaaaagggtaaatatgagataacagaggaa
atgaagaagagattaaatatattatatggagattttgcagatgaagatgatacacttaaa
gctattgaaaaagtctatgaaaattccgattatcttatagatactcatactgcagtagct
tatagggtttatgaaaaatataaaaataaaacaggagataatagggttactattatagca
tccactgcaagtccattcaaatttcctaaaagtataaatgaagtgttaaatataggacat
gaaaatgcttcagattttgaacttattaatttattttcagataaattaaatttaaagttg
cctaaaggattagaaggactagaggaaaaagaaatttgtcataaggtcacttgtaaaaag
gatgaaatgaagaaagtaattaaaaattttttaggaatatag

DBGET integrated database retrieval system