KEGG   Clostridium botulinum F Langeland: CLI_2059Help
Entry
CLI_2059          CDS       T00563                                 

Gene name
pfkB
Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00010  Glycolysis / Gluconeogenesis
cbf00030  Pentose phosphate pathway
cbf00051  Fructose and mannose metabolism
cbf00052  Galactose metabolism
cbf00680  Methane metabolism
cbf01100  Metabolic pathways
cbf01110  Biosynthesis of secondary metabolites
cbf01120  Microbial metabolism in diverse environments
cbf01130  Biosynthesis of antibiotics
cbf01200  Carbon metabolism
cbf01230  Biosynthesis of amino acids
Module
cbf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLI_2059 (pfkB)
   00030 Pentose phosphate pathway
    CLI_2059 (pfkB)
   00051 Fructose and mannose metabolism
    CLI_2059 (pfkB)
   00052 Galactose metabolism
    CLI_2059 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    CLI_2059 (pfkB)
Enzymes [BR:cbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLI_2059 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABS41493
UniProt: A7GEV7
Position
complement(2188254..2189177)
Genome map
AA seq 307 aa AA seqDB search
MIYTLTTNPAIDMNCSSSSNEAFKVNRTNNLSYSPNGKGVNVSLVLNHYSIESKALGFFG
GFTGKYIVEELDKKNIFTEAFWIEENTRINVFINTEDNKEFKYVNKGPFVSRDTQKDLLK
YLSSNFKKGDYLIISGSLPQSIQEDYYNEILDICMENNVQVILDISSKKLKELLKYKPLL
IKPNDEEVEAIFGLSLKNEEDIKEALKYIYKLGAKNILLTLGEKGMYFYNGEKIYYCNAP
KIKLLSSACAGDSALAAFLSEWLYESNIEKALKKASATGANVAESSALGTFSKVSEYIKK
IHVKEVM
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacattaactactaatccagctattgatatgaactgttcttccagtagtaat
gaagcttttaaggtaaatagaaccaataatttatcttattcacctaatggaaaaggagta
aatgtatcactagttttaaatcattattctatagagagtaaagctcttggatttttcgga
ggatttacaggaaagtatattgtagaggaattagataagaaaaatatatttacagaggct
ttttggatagaagaaaatacaaggataaatgtatttataaatacggaagataataaagaa
tttaagtatgtaaacaagggaccttttgtttcaagggatacccaaaaggatctattaaaa
tacttatcatcaaattttaaaaaaggtgattatttaataataagtggaagtcttcctcaa
agtattcaagaggattactacaatgaaattttagatatatgtatggaaaataatgttcaa
gttatattagatataagctctaaaaaattaaaagaattattgaaatataagcctttatta
attaaacctaatgatgaagaagttgaggcaatatttggactaagtttaaaaaatgaagag
gatataaaagaggcattaaaatatatttataagttaggtgctaaaaatatacttctaacc
ttaggggagaaaggaatgtatttttacaatggagagaagatttattattgcaatgcacct
aaaattaaacttttaagctctgcttgtgcaggggattcggccttagcagcatttttaagt
gaatggttatatgaatctaatatagaaaaggcacttaaaaaggcatcagccactggtgca
aatgttgctgaatctagtgcattaggaacttttagtaaagtatcagagtatataaaaaaa
atacatgttaaggaggtaatgtaa

DBGET integrated database retrieval system