KEGG   Clostridium botulinum F Langeland: CLI_2059Help
Entry
CLI_2059          CDS       T00563                                 

Definition
PfkB family kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLI_2059
   01230 Biosynthesis of amino acids
    CLI_2059
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLI_2059
   00030 Pentose phosphate pathway
    CLI_2059
   00051 Fructose and mannose metabolism
    CLI_2059
   00052 Galactose metabolism
    CLI_2059
  Energy metabolism
   00680 Methane metabolism
    CLI_2059
Enzymes [BR:cbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLI_2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2188254..2189177)
Genome map
AA seq 307 aa AA seqDB search
MIYTLTTNPAIDMNCSSSSNEAFKVNRTNNLSYSPNGKGVNVSLVLNHYSIESKALGFFG
GFTGKYIVEELDKKNIFTEAFWIEENTRINVFINTEDNKEFKYVNKGPFVSRDTQKDLLK
YLSSNFKKGDYLIISGSLPQSIQEDYYNEILDICMENNVQVILDISSKKLKELLKYKPLL
IKPNDEEVEAIFGLSLKNEEDIKEALKYIYKLGAKNILLTLGEKGMYFYNGEKIYYCNAP
KIKLLSSACAGDSALAAFLSEWLYESNIEKALKKASATGANVAESSALGTFSKVSEYIKK
IHVKEVM
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacattaactactaatccagctattgatatgaactgttcttccagtagtaat
gaagcttttaaggtaaatagaaccaataatttatcttattcacctaatggaaaaggagta
aatgtatcactagttttaaatcattattctatagagagtaaagctcttggatttttcgga
ggatttacaggaaagtatattgtagaggaattagataagaaaaatatatttacagaggct
ttttggatagaagaaaatacaaggataaatgtatttataaatacggaagataataaagaa
tttaagtatgtaaacaagggaccttttgtttcaagggatacccaaaaggatctattaaaa
tacttatcatcaaattttaaaaaaggtgattatttaataataagtggaagtcttcctcaa
agtattcaagaggattactacaatgaaattttagatatatgtatggaaaataatgttcaa
gttatattagatataagctctaaaaaattaaaagaattattgaaatataagcctttatta
attaaacctaatgatgaagaagttgaggcaatatttggactaagtttaaaaaatgaagag
gatataaaagaggcattaaaatatatttataagttaggtgctaaaaatatacttctaacc
ttaggggagaaaggaatgtatttttacaatggagagaagatttattattgcaatgcacct
aaaattaaacttttaagctctgcttgtgcaggggattcggccttagcagcatttttaagt
gaatggttatatgaatctaatatagaaaaggcacttaaaaaggcatcagccactggtgca
aatgttgctgaatctagtgcattaggaacttttagtaaagtatcagagtatataaaaaaa
atacatgttaaggaggtaatgtaa

DBGET integrated database retrieval system