KEGG   Clostridium botulinum F Langeland: CLI_2453Help
Entry
CLI_2453          CDS       T00563                                 

Gene name
ptsH
Definition
(GenBank) phosphocarrier protein HPr
  KO
K11189  
phosphocarrier protein
Organism
cbf  Clostridium botulinum F Langeland
Brite
Transporters [BR:cbf02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8 4.A.2]
    CLI_2453 (ptsH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2574799..2575056)
Genome map
AA seq 85 aa AA seqDB search
MLERELTVNSSTGLHARPATLLVKKASSFKSDLSIEFNGKKANIKSLIGVLSLGVTSGAK
IKLIASGDDETLAIEEISKLINTLE
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaagagaattaactgtaaacagttcaactggtttacatgcaagaccagcaact
ttattagtaaaaaaggcttcatcctttaaatcagatttatctattgaatttaatggtaaa
aaagccaacataaagagtcttataggagttctttcattaggagttacaagtggagcaaaa
ataaaattaatagcttctggtgatgatgaaaccctagctatagaagaaatctcaaaatta
ataaatacattagaataa

DBGET integrated database retrieval system