KEGG   Clostridium botulinum F Langeland: CLI_2453Help
Entry
CLI_2453          CDS       T00563                                 

Gene name
ptsH
Definition
phosphocarrier protein HPr
Orthology
K11189  
phosphocarrier protein
Organism
cbf  Clostridium botulinum F Langeland
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2574799..2575056)
Genome map
AA seq 85 aa AA seqDB search
MLERELTVNSSTGLHARPATLLVKKASSFKSDLSIEFNGKKANIKSLIGVLSLGVTSGAK
IKLIASGDDETLAIEEISKLINTLE
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaagagaattaactgtaaacagttcaactggtttacatgcaagaccagcaact
ttattagtaaaaaaggcttcatcctttaaatcagatttatctattgaatttaatggtaaa
aaagccaacataaagagtcttataggagttctttcattaggagttacaagtggagcaaaa
ataaaattaatagcttctggtgatgatgaaaccctagctatagaagaaatctcaaaatta
ataaatacattagaataa

DBGET integrated database retrieval system