KEGG   Clostridium botulinum F Langeland: CLI_2482Help
Entry
CLI_2482          CDS       T00563                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
cbf00900  Terpenoid backbone biosynthesis
cbf01100  Metabolic pathways
cbf01110  Biosynthesis of secondary metabolites
cbf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLI_2482 (dxr)
Enzymes [BR:cbf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CLI_2482 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Semialdhyde_dh Glycoprotein DapB_N
Motif
Other DBs
NCBI-ProteinID: ABS39449
UniProt: A7GG14
Position
complement(2608875..2610032)
Genome map
AA seq 385 aa AA seqDB search
MKNITILGATGSIGTQTLDVIRREKEELKLVAISANKSYKKVIEIIKEFKPKYTVLMEEN
AFKIVEDFCIDNKIDTKVLKGMEGMIYISTLEEVNTVVTSVVGMIGLVPTIKAIESGKDI
ALANKETLVVAGELVISKAKEHNVNILPVDSEHGAIFQCLRGNKKEEVKNIIVTASGGPF
RGKKKEELIDVKPEHALKHPKWNMGRKISIDSATLMNKGLEVIEAHFLFGVDYENIKVVV
HPQSIVHSMVEYKDGSVIAQMATPDMKLPIQYALNYPNRKESQIEPLDFYKISNLTFEKP
DMDTFLPLKLAYEAGKKGGVMPAILNGANEVAVDLFLKGKIEFLQIGDLLQECMNKFYKS
MEATLENVISVDKEVREYLGKKYDI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaacattaccatattaggcgcaacaggttctattggaacccaaactttagatgta
ataagaagagaaaaggaagaattaaaattagtagccatatccgcgaataaaagctataaa
aaagttatagaaattataaaggaatttaaacctaaatatacggttttaatggaagagaat
gcttttaaaatagtagaagatttttgtatagataataaaatagatacaaaagttttaaaa
ggtatggaaggaatgatatatataagcaccttagaggaggtaaatacagtagttacctct
gtggtaggaatgataggattagttccaaccataaaagctatagaaagtggaaaagatata
gctttagctaacaaagaaaccttagtagtagctggagaactagttattagtaaagctaaa
gagcataatgtaaatatattacctgtagattcagaacacggagctatttttcaatgttta
agaggaaataaaaaggaagaagttaaaaatataatagtaacagcttcaggaggacctttt
agaggtaaaaagaaggaagaactcatagatgtaaagccagagcatgctcttaaacatcct
aaatggaatatgggaagaaaaatatctatagattctgccacattaatgaataaagggtta
gaggttatagaagctcactttttatttggtgtggattatgaaaatataaaggtggtggta
catccacaaagtatagttcattctatggtagaatataaagatggaagtgtaatagcacaa
atggcaactccagatatgaaattacctatacaatatgctttgaattatcctaataggaaa
gaaagtcaaatagaacctttagatttttataaaatatctaatttaacctttgaaaaaccg
gatatggatacattcttaccactaaagttggcttatgaagcagggaaaaaaggtggagta
atgccagccatattaaatggggccaatgaggttgcagtagatttatttttaaagggcaaa
atagaatttttacaaataggtgacctattacaagaatgtatgaataaattttataaatct
atggaagctacattagagaatgtaataagtgtagataaggaagttagagagtatttaggt
aaaaaatatgatatataa

DBGET integrated database retrieval system