KEGG   Clostridium botulinum F Langeland: CLI_3227Help
Entry
CLI_3227          CDS       T00563                                 

Gene name
folC
Definition
bifunctional folylpolyglutamate synthase/dihydrofolate synthase (EC:6.3.2.12 6.3.2.17)
Orthology
K11754  
dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(3405865..3407154)
Genome map
AA seq 429 aa AA seqDB search
MDYKEAREYIQSKAKFGSNLGLERTEKLLELLGNPHKRLRCIHIAGTNGKGSTTAMISAV
LKESGYKVGMYTSPYIEEFEERIQINGHNITKEDLGYIITKVANIVEKVENMGYGNPTEF
EIITVAMFYYFCLKEVDFAVIEVGLGGRLDSTNVLEPILSIITSISYDHMNILGETLEEI
TYEKAGIIKKAPVIMYPQKKEVEKNIEKVCKEKNCDLIKVEDNLINIEIEIIEKNMGQQS
FKLKTKEDTYNICLSLLGEHQIKNCITVILALEKLMKLGIKIEKIHIISALKKVKWPARL
EIVNKNPLTVIDGAHNIDGIESLKNNVSKYFKYNKLILILGILKDKQVEDMIKTLVPLAD
RVLTVAPHNDRGESSKELMHIVLKHNESCEHLEDYKECYDKAKFYCEDGDMILICGSLYM
VGDMRKLIR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggattataaagaagctagagagtatatacaatcaaaggctaagtttggtagtaatcta
ggcctagagagaacagaaaagcttttagagttattgggaaaccctcataagaggttaaga
tgcatacatatagcaggtacaaatggaaaaggatctactacagctatgatttctgcagta
ttaaaagagtctggctataaagttggaatgtatacatccccttatatagaggagtttgaa
gaaagaatacaaataaatggccataatataactaaggaagatttaggttatattataact
aaggtagctaatatagtggaaaaggtagaaaatatgggatatggaaatcctacagaattt
gaaattataactgttgctatgttttattatttttgtttaaaagaagtagattttgcggtg
atagaagtaggtttagggggacggttagactctactaatgttttagaacctattttaagt
attataacttctataagttatgatcatatgaatattttaggtgaaaccctagaagaaata
acttatgaaaaagcaggaataataaaaaaagctcctgttataatgtatccacaaaagaaa
gaagtagaaaaaaatatagaaaaggtgtgtaaggaaaaaaattgtgatcttataaaagta
gaagataatttaataaatatagaaatagaaatcatagaaaaaaatatggggcagcaaagt
tttaaattaaaaactaaagaagatacttataatatatgtttatccttattaggagaacat
caaataaaaaactgtattacagttatattagccttagaaaagttaatgaaattaggtata
aaaatagaaaaaatacacataatatcagcccttaaaaaagtgaaatggccagctagacta
gaaatagtaaataaaaatcctctaacagtaatagatggagcccataatatagatggcata
gaaagcttaaaaaataatgtgagtaaatattttaaatataataaacttattttaatatta
ggcatattaaaagataaacaagtagaagacatgataaaaacattagtaccactagcagat
agagtattaacagtagctcctcataatgatagaggggaaagttcaaaagaattaatgcac
attgtattaaaacataatgaaagttgtgaacatctagaggactataaagaatgttatgat
aaggcaaaattttactgtgaagatggagatatgattttaatttgtgggtcattatacatg
gtaggtgatatgagaaaattaataaggtaa

DBGET integrated database retrieval system