KEGG   Clostridium botulinum F Langeland: CLI_3516Help
Entry
CLI_3516          CDS       T00563                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cbf  Clostridium botulinum F Langeland
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbf01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cbf00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(3666949..3668340)
Genome map
AA seq 463 aa AA seqDB search
MEINKIIEELKDDLIDSTAELVKIKSIEGEAKEGKPYGEGVASALEKALEISEKLGFKTV
NVDGYVGYAEYGEGDEYVGVLGHLDLVPEGDGWKYPPYGAEIHDGKMYGRGTTDDKGPIM
AALYGLKAIKESKLPLSKKVRILFGTNEETGSKEIEHYLEKEKPPVLGFTPDAEYPIIYA
EKGITIFDIVKKLEIKSSKAIKLKYIKGGEASNMVPDYCEAGIECPDTDMIIRSLEYCAN
RNGIELTAEEKGGLVVIKSFGLSAHGSTPEIGKNAIMQMFKFLAELPLGHCDELQFIRFF
NNNVGNETDGKTFGVELEDEPSGKLSFNVGTISMENNEIRMSLNLRYPVTYKSEDLMEKF
NKKIDGTGIKVENFEDQKPLYFDAEHQLIKSLQKVYKEQTGKEPELLAIGGGTYAKEMPN
MVAFGPLFPGEPDVIHKKDEYIELENLVLNAKIYGHAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttggagataaataaaataatagaagagctaaaagatgatcttatagactctactgcagaa
ttagttaaaattaagagtatagaaggcgaagcaaaggaaggtaaaccttatggggaaggc
gtagccagtgctttggaaaaagcattagaaataagtgaaaagctaggttttaaaactgta
aacgtagatggatatgttggatatgctgaatacggtgaaggtgatgaatatgtaggtgtt
ttaggtcatttggatttagtaccagaaggagatggatggaagtatccaccttatggagca
gaaatacatgatggaaaaatgtatggtagaggaactacagatgacaaggggcctataatg
gcagcactttacggtttaaaagccataaaagaatcaaaacttcctttatctaaaaaggtt
agaatcttgtttggaacaaatgaagaaacaggttctaaagaaatagaacattatttagaa
aaggaaaaaccaccagtacttggatttactccagatgctgagtatccaataatctatgct
gaaaaaggaattacaatatttgatatagtaaaaaaattagaaataaaaagtagcaaagct
attaaattaaaatatattaaaggtggagaagcatctaatatggtgccagattattgtgaa
gctggtatagaatgtccagatacagatatgataataagatctttagagtattgtgctaat
agaaatgggatagaattaacagcagaagaaaaaggtggtttggtagtaattaaatctttt
ggactatccgctcatggaagtacaccagagattggtaagaatgctataatgcaaatgttt
aaatttttagcagaacttccattaggtcattgtgatgaattacaattcataagatttttt
aataataatgtaggaaatgaaactgatggtaaaacttttggtgtagagctagaagatgaa
ccatcaggtaagttaagttttaatgtaggaactatttctatggaaaataatgaaataaga
atgtcattaaatttaagatatcctgtaacatataaatcagaagatcttatggaaaagttc
aataaaaagatagatggaacaggaataaaagtagaaaattttgaggatcaaaaaccttta
tattttgatgcagaacaccaattaataaaatcattacaaaaggtatataaagaacaaaca
ggaaaagaaccagaattactagctataggtggaggaacttatgcaaaagaaatgcctaat
atggttgcctttggaccacttttccctggagaaccagatgtaattcataaaaaagatgaa
tatatagaactagaaaatttggtgttaaatgccaaaatatacgggcatgctatatatgaa
ttagccaaatag

DBGET integrated database retrieval system