KEGG   Clostridium botulinum F Langeland: CLI_3522Help
Entry
CLI_3522          CDS       T00563                                 

Definition
sigma-70 family RNA polymerase sigma factor
Orthology
K03088  
RNA polymerase sigma-70 factor, ECF subfamily
Organism
cbf  Clostridium botulinum F Langeland
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(3673901..3674473)
Genome map
AA seq 190 aa AA seqDB search
MGLSDEELVNEIISGNRSAMEVLVNRNYKLVYAFIYRNIGEYHTTLDLTQESFIKIMKSL
KMFKSHKGNFQCWILKIALNVCKDYWKSAYIKHNTVDDSSLEKVYEKGNIINYLEKIEER
QEIKKAMMALSEEQREVIILRYYNDLKIRDIANITEIKESTVKSRLRLAIGKLKTLLQRG
EKHEKDKRSI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgggactaagtgatgaagaattggttaatgaaattattagtggaaaccggtctgctatg
gaagtacttgtaaatagaaattataaattggtatatgcttttatatatagaaatatagga
gagtatcatactacactggatttgactcaggagagttttataaaaattatgaaaagcttg
aaaatgtttaaaagtcataagggcaatttccaatgctggatcttaaaaatagctttaaat
gtttgtaaagattattggaaaagtgcttatattaaacataatactgttgatgatagttct
ttagagaaagtttatgaaaagggaaatattataaattatttagaaaagattgaagaaaga
caggaaattaaaaaagctatgatggcactgtcagaggaacaaagagaagtaatcatattg
agatattacaacgatttaaaaataagggatatagctaatataacagaaataaaagagtcc
actgtaaagtcaagattaaggcttgctataggaaagctaaaaacattactacaaaggggg
gaaaagcatgaaaaagacaaaagaagtatttga

DBGET integrated database retrieval system