KEGG   Coxiella burnetii CbuG_Q212: CbuG_0557Help
Entry
CbuG_0557         CDS       T00787                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg00010  Glycolysis / Gluconeogenesis
cbg00051  Fructose and mannose metabolism
cbg00562  Inositol phosphate metabolism
cbg01100  Metabolic pathways
cbg01110  Biosynthesis of secondary metabolites
cbg01120  Microbial metabolism in diverse environments
cbg01130  Biosynthesis of antibiotics
cbg01200  Carbon metabolism
cbg01230  Biosynthesis of amino acids
Module
cbg_M00002  Glycolysis, core module involving three-carbon compounds
cbg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuG_0557 (tpiA)
   00051 Fructose and mannose metabolism
    CbuG_0557 (tpiA)
   00562 Inositol phosphate metabolism
    CbuG_0557 (tpiA)
Enzymes [BR:cbg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CbuG_0557 (tpiA)
Exosome [BR:cbg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CbuG_0557 (tpiA)
  Exosomal proteins of bladder cancer cells
   CbuG_0557 (tpiA)
  Exosomal proteins of melanoma cells
   CbuG_0557 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACJ17971
Position
524375..525190
Genome map
AA seq 271 aa AA seqDB search
MIPLEWRQISAWRGCHMQRRPLVAGNWKMHGSRESVGQLLRALKHGCERLETAELAVFPP
FVFLQQCEEALMRTQISWGAQDVSEFERGAYTGEVSAAMLRDFHCRYVIVGHSERRQRHG
ETNEQVAAKVRAALRCGIRPIICVGETEKQRNANQTLSVIKEQLAVVLQMNDNLASLEGM
VVAYEPIWAIGTGKNATPSQAEEVHAALRDQLHRQDATLAESTRLLYGGSVKPDNAAALF
EMPNIDGALVGGASLEAEQFLKIGQQCNQSF
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgattccgctagaatggcgccagatttcagcatggagaggatgtcatatgcagcgtcga
ccgttagtggctggtaattggaaaatgcatggttcgcgcgaaagtgtgggtcaattatta
agggcattaaaacacggttgcgagcgtctggaaacggcggagctcgctgttttcccccct
tttgtctttttgcagcaatgcgaagaggcgctgatgcgaacgcaaatctcttggggtgcg
caggacgtttccgaattcgaaagaggcgcttatacgggggaagtctctgctgccatgctg
cgcgatttccattgccggtatgtaatcgtcggccactcggaaaggcgtcagcgtcacgga
gaaaccaatgagcaagtggctgcgaaggttagggcagccctccgttgcggcattcgtccc
attatttgtgtaggggaaactgaaaagcagcgcaatgctaatcagacattatcagtgata
aaagagcaacttgcagttgtattgcagatgaacgataatttggcgtcgttggaaggcatg
gtggtggcttatgagccgatatgggcgattggaaccggaaaaaatgcaacgccttcgcaa
gcagaagaagtgcacgcagcccttcgagatcaattacaccgtcaggatgcgacactagcc
gaaagcacgcggcttttatatgggggcagtgttaagccggataatgcagccgctttgttt
gaaatgccaaatatagatggcgctttagtgggtggggcttctttggaagctgaacaattt
ctaaaaatagggcaacaatgcaatcaatcattttaa

DBGET integrated database retrieval system