KEGG   Coxiella burnetii CbuG_Q212: CbuG_0611Help
Entry
CbuG_0611         CDS       T00787                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg00020  Citrate cycle (TCA cycle)
cbg00190  Oxidative phosphorylation
cbg00650  Butanoate metabolism
cbg01100  Metabolic pathways
cbg01110  Biosynthesis of secondary metabolites
cbg01120  Microbial metabolism in diverse environments
cbg01130  Biosynthesis of antibiotics
cbg01200  Carbon metabolism
Module
cbg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cbg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CbuG_0611 (sdhD)
   00650 Butanoate metabolism
    CbuG_0611 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    CbuG_0611 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF1211 CybS
Motif
Other DBs
NCBI-ProteinID: ACJ18020
Position
572967..573314
Genome map
AA seq 115 aa AA seqDB search
MDMVDRTSRRGYRDWFVQRITALLSGIYAVFVIVFLLVHYPISYPQWHALFSHLIMKIFT
LIVIFSILWHAWIGMWTIFTDYVKNKPIRLALETLVCLLLVGYFVWAIEFLWIAR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
gtggatatggtagataggaccagccgtcgcggctatcgtgactggttcgttcagcggatt
accgccttattaagcggtatttatgcggtttttgtcattgtttttttgctcgtccactat
cccatttcttaccctcagtggcacgcattatttagtcatttaataatgaaaatattcacc
ctcatcgttattttcagcattttatggcacgcctggattggcatgtggacaatctttacc
gattatgtaaaaaacaaacccatacggctcgctttagagactctggtttgtttattgtta
gtgggctatttcgtatgggccatcgaatttttgtggatagcgcgttga

DBGET integrated database retrieval system