KEGG   Coxiella burnetii CbuG_Q212: CbuG_0616Help
Entry
CbuG_0616         CDS       T00787                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbuG_0616 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CbuG_0616 (sucC)
   00640 Propanoate metabolism
    CbuG_0616 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CbuG_0616 (sucC)
Enzymes [BR:cbg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CbuG_0616 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
580065..581237
Genome map
AA seq 390 aa AA seqDB search
MNLHEYQSKHLLKKYNIPVPASEVVFNPDAAVDAAAKIGGDRWVVKAQVHAGGRGKAGGV
RLVKNKEELKSAVKALLGMRLVTYQTDERGQPVNQILVEQTSDIARELYLGAVIDRASQR
IVFMASTEGGVEIEKVAEKSPEKILKVTVDPAIGLQPFQCRQLFFGLGLQDLKQMRSFTD
IVMGLYRLFTERDLSLLEINPLVITGSGELICLDAKINIDDSALYRQSELREMRDTTQED
EHETMAQQWELNYIKLDGNIGCMVNGAGLAMATMDLIKLSGGDPANFLDVGGSATKERVT
EAFKIIVSDKNVKGILVNIFGGIVRCDLIADGIISAVKEVGIDVPVVVRLEGNNAQLGAK
KLADSGMNIIAAKGFADAAEQIVKQVGVIA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacatgaatatcaatcaaaacatttattaaaaaaatacaacatccccgttcct
gccagcgaagtggttttcaatcccgacgccgctgtcgatgcggccgctaaaatcggtggc
gatcgttgggttgtcaaagcccaagtgcatgccggaggtcgtggtaaagcgggtggtgtg
cgtttagtgaagaataaagaagaattaaaatcggccgtcaaggcattattaggcatgcgg
ttagtcacctatcaaaccgatgaacgtggccagccggtgaatcagatcctcgttgaacaa
acttctgatatagcacgggaattgtacctaggggcggtgattgatcgtgcttctcaacgt
atcgttttcatggcgtcgactgaaggcggtgtggaaattgaaaaagtcgctgaaaaatcg
cctgaaaaaatactaaaagttactgttgacccggccattggtttacaaccctttcaatgt
cgccaattattttttggtttagggctccaagacttaaaacaaatgcgctcattcaccgat
attgtgatgggcttataccgattatttaccgagcgcgatttaagcttattagaaattaat
ccattggtcatcactggttcgggtgaactcatttgtttggatgccaaaatcaatatcgat
gacagcgcgctttatcgtcaatccgaattgcgcgaaatgcgagacaccactcaagaagat
gagcatgaaacgatggcccaacaatgggaattaaattacatcaaactggatggaaatatc
ggttgtatggtaaacggtgctggacttgccatggcaacgatggatttaatcaaactgtcc
ggtggcgatcctgctaatttcctcgacgttggcggcagcgctactaaagaacgcgtgaca
gaagcgtttaagattattgtatcggataaaaatgttaaaggcattttagttaatattttc
ggtggtattgttcgttgcgatctcatcgctgacggaattatcagtgcagtaaaagaagtt
ggcattgatgtgccagtggttgttcggcttgaaggaaataatgctcagttgggtgcaaaa
aaattggcagatagtggcatgaatattatcgccgccaaaggatttgccgatgcagcggaa
caaattgtcaaacaagtaggggtgatcgcataa

DBGET integrated database retrieval system