KEGG   Coxiella burnetii CbuG_Q212: CbuG_0660Help
Entry
CbuG_0660         CDS       T00787                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CbuG_0660 (folP)
Enzymes [BR:cbg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CbuG_0660 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
625409..626302
Genome map
AA seq 297 aa AA seqDB search
MMSKEAFFLKQSFHLRLRDDKRIVFSEPAVMGIINVSPNSFYHPHLDLNSALRTAEKMVD
EGADILDIGGEATNPFVDIKTDSPSTQIELDRLLPVIDAIKKRFPQLISVDTSRPRVMRE
AVNTGADMINDQRALQLDDALTTVSALKTPVCLMHFPSETRKPGSTTHFYFLQSVKKELQ
ESIQRCKKAGISEDRIIIDPGFGQGNYGKNVSENFYLLNKLPEFVAMGLPVLSGWSRKSM
IGDVLNQPPENRLFGSIAADVLAVYHGASIIRTHDVKATREAIKIATYTRSVDTIEE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtaaggaggcatttttcttgaagcagtcattccacctacggttgcgcgacgat
aaacgcattgttttttctgaacccgcggtaatggggataatcaatgtctctcccaattca
ttctaccatccgcaccttgatctaaattcggcgttgcgtacagcagaaaaaatggtggat
gaaggcgccgatattttggatattgggggtgaggccaccaacccttttgttgatatcaaa
accgattcgccttccacgcaaatagaattagatcgactgttgcccgtcattgatgctata
aaaaaacgatttccccaattaatttcggtggacaccagtcgtcctcgtgtaatgcgtgag
gcggtaaatacgggcgctgacatgatcaatgatcagcgcgctctgcaattggacgatgct
ttaacaaccgtttcagcgttaaaaacgcctgtttgtttgatgcattttccgtccgagacg
agaaaaccaggatcaacaacgcatttctatttccttcaatccgttaagaaagagttgcaa
gaaagcatccaacgttgtaaaaaagcgggtatttccgaagaccgaattatcatcgatccg
ggttttgggcaagggaattacggtaaaaatgtgtcagagaatttttatttattgaacaaa
ttacctgaatttgtggcaatgggattacccgtcttatcggggtggtcgcgaaaatcaatg
attggagatgttttaaatcaaccgcccgaaaatcgcttatttggaagtatcgcggctgat
gtattagctgtttaccatggtgcgtcaataatccgcacccatgacgtcaaagcaacacga
gaagcgataaaaattgcgacctatacgcgaagtgttgatacaattgaggagtag

DBGET integrated database retrieval system