KEGG   Coxiella burnetii CbuG_Q212: CbuG_0736Help
Entry
CbuG_0736         CDS       T00787                                 

Definition
6-phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbuG_0736
   01230 Biosynthesis of amino acids
    CbuG_0736
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuG_0736
   00030 Pentose phosphate pathway
    CbuG_0736
   00051 Fructose and mannose metabolism
    CbuG_0736
   00052 Galactose metabolism
    CbuG_0736
  Energy metabolism
   00680 Methane metabolism
    CbuG_0736
Enzymes [BR:cbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CbuG_0736
Protein phosphatases and associated proteins [BR:cbg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CbuG_0736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(702829..704091)
Genome map
AA seq 420 aa AA seqDB search
MSKKNVFYAQSGGATAVINATACGVIQTAAQYPTKIGKVLAGRNGIIGALKEELIDTSLE
SLENIAALRHTPSSAFGSCRYKLNNIHHDRRQYERLIEVFKAHDIGYVFYNGGGDSQDTT
HKISQLSQLMDYPLVCIGLPKTIDNDLPFTDNCPGFGSVAKYIAVSTQEAALDVRGMCAT
STKIFILEVMGRHAGWIAASSALGKSQPDDAPHLILFPEVPFQTEQFLTKVSRSVEKNGY
CVIVASEGIRHPDGRFVAESGLHDAFGHEQLGGVAPILARLIKKRLNFKYHWAVADYLQR
AARHIASQTDLDQAYALGKTAVEFALAGKSDVMLTIQREMGSDYKWRIGTAPLCEVANVE
HKMPSHYISEDGFGITEACYTYLKPLIEGESYPPYKNGVPDYVTLKNQLVAKKLKEAFAV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaaacgtcttctacgcccaatcgggcggtgccacggcggtgattaatgcg
acagcctgcggagtcatacaaacagccgctcaatatcccactaaaattggaaaagttctg
gcgggacgtaacgggattattggtgctcttaaagaggagctcattgataccagtctggag
tctcttgaaaatatcgctgctttgcggcacaccccttcgagcgcttttgggtcctgccgc
tataaactgaacaatatccatcacgatcgccgtcaatatgagcggcttatcgaagttttt
aaagcgcatgatatcggctacgtgttttacaacggcggtggcgattcccaagacaccacg
cataaaatttcgcagttaagccaactaatggattatcccctggtttgcattggtctaccc
aaaaccatcgataacgatctcccttttactgataattgtccgggctttggttctgttgct
aaatatattgctgtttccactcaagaagcggctttggatgtacgcggtatgtgtgcgacc
tcgaccaagatttttattctggaggtcatggggcgccatgcgggctggattgcggcgtcg
tctgcattgggaaaatcccaacctgacgacgcgccacacttgattctatttcccgaagtt
cccttccaaaccgaacaattcctaacaaaagtaagcagatccgttgaaaaaaatgggtat
tgtgtcattgtggcttctgaaggtatccgtcatcccgacggacgatttgtagcggaatcc
ggattgcacgacgcttttggccatgaacaattaggcggggtggcacctattttagcaagg
ctgatcaaaaaacgacttaattttaaataccattgggccgttgcggattatttacaacga
gcggcccgccacattgcctctcaaacggatcttgatcaagcgtacgctctaggaaaaacc
gccgtggaattcgcgcttgctggaaaatccgatgtgatgctcaccatccaacgcgaaatg
ggttctgattataagtggcgcatcggcacggctcccttgtgcgaagtcgctaatgtggag
cacaaaatgccaagccattatatcagcgaagatggatttggcatcacagaagcttgctat
acgtatcttaaacctctgattgaaggggaaagctaccccccttataaaaatggggtaccc
gattacgtcaccctaaaaaaccagttggttgcgaagaaattgaaggaagcttttgctgtt
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system