KEGG   Coxiella burnetii CbuG_Q212: CbuG_1085Help
Entry
CbuG_1085         CDS       T00787                                 

Definition
acyl-CoA desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cbg01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cbg01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1048240..1049355)
Genome map
AA seq 371 aa AA seqDB search
MKQISKINWLNVSFIILTGLVGITGTILFIVFGLVHWPTWVLAGAMLIACGLSITAGYHR
LAAHKSYKAVWPIRLFFALFGAAAFEGSIVEWATDHRKHHRYTDTDQDPYSIKKGFWYAH
IGWLFTLDPSKRDFSNVQDLLDDPIYRFQHRFFPIIAILMGFGLPMAIGALWGDPLSALV
IAGALRITVVYQMTFFINSLCHMIGKQTYKNSSARDNWVTALLTMGEGFHNFHHQFPIDY
RNGVRFFHFDPTKWLIYLLSRMGLVSSLKRVEQRRIIKYRLQTDTQRLALLSAERVEVVK
PLYERIHHLLGRLEELEKSYLALKEAQFKAYKNRLREIRQKLKATERELRTFLTLWSKVA
RPLQTCQLSGS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatttcaaaaatcaactggttaaacgtctcgtttatcattcttacagggctt
gtaggaatcactggtaccatacttttcatcgtttttggccttgttcattggccgacgtgg
gttttggcgggggcgatgcttattgcttgcggtctttcgataacagcgggttaccaccgc
cttgccgctcataaaagctacaaggcggtatggcctattcggttattttttgcgcttttt
ggagcggcggcttttgaaggaagtattgtagaatgggccactgaccatcgaaagcatcac
cgttataccgacacagaccaagatccctacagcatcaaaaaaggcttttggtatgcccac
ataggatggctatttacgcttgatccttcaaaacgggattttagcaatgtccaagatttg
ctggatgatcctatctatcgctttcaacatcgtttctttccgattattgctattctaatg
ggttttggattgccaatggccattggcgcgctttggggcgacccgctcagcgctcttgtg
attgctggcgctttaaggattacggtggtttatcagatgacgttttttattaattcactt
tgtcatatgattggcaaacaaacttacaaaaattcatctgctcgggataattgggtaacc
gccctgcttactatgggcgaaggttttcataattttcaccatcaatttccgattgattat
cgaaacggcgtgcgcttttttcactttgatccaacgaaatggttgatttatttgttatcc
cggatgggattggtgtctagcttaaagcgcgtagagcaacgcagaatcattaaataccgt
ctgcaaaccgatactcaacgtttggcactgctttcagcagaaagagtagaggtcgtaaaa
ccgctttatgagcgcattcatcacttgttagggcggctggaagaacttgaaaagagttat
ttagcattgaaagaggcgcaatttaaggcttataaaaaccgactccgagaaatacgacaa
aagctaaaagcaacggagcgcgagcttcgaactttcttaactctgtggagcaaggtggcc
cggccgcttcagacttgtcaacttagtggatcataa

DBGET integrated database retrieval system