KEGG   Coxiella burnetii CbuG_Q212: CbuG_1085Help
Entry
CbuG_1085         CDS       T00787                                 

Definition
acyl-CoA desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CbuG_1085
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CbuG_1085
Enzymes [BR:cbg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CbuG_1085
Lipid biosynthesis proteins [BR:cbg01004]
 Desaturase
  First
   CbuG_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1048240..1049355)
Genome map
AA seq 371 aa AA seqDB search
MKQISKINWLNVSFIILTGLVGITGTILFIVFGLVHWPTWVLAGAMLIACGLSITAGYHR
LAAHKSYKAVWPIRLFFALFGAAAFEGSIVEWATDHRKHHRYTDTDQDPYSIKKGFWYAH
IGWLFTLDPSKRDFSNVQDLLDDPIYRFQHRFFPIIAILMGFGLPMAIGALWGDPLSALV
IAGALRITVVYQMTFFINSLCHMIGKQTYKNSSARDNWVTALLTMGEGFHNFHHQFPIDY
RNGVRFFHFDPTKWLIYLLSRMGLVSSLKRVEQRRIIKYRLQTDTQRLALLSAERVEVVK
PLYERIHHLLGRLEELEKSYLALKEAQFKAYKNRLREIRQKLKATERELRTFLTLWSKVA
RPLQTCQLSGS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatttcaaaaatcaactggttaaacgtctcgtttatcattcttacagggctt
gtaggaatcactggtaccatacttttcatcgtttttggccttgttcattggccgacgtgg
gttttggcgggggcgatgcttattgcttgcggtctttcgataacagcgggttaccaccgc
cttgccgctcataaaagctacaaggcggtatggcctattcggttattttttgcgcttttt
ggagcggcggcttttgaaggaagtattgtagaatgggccactgaccatcgaaagcatcac
cgttataccgacacagaccaagatccctacagcatcaaaaaaggcttttggtatgcccac
ataggatggctatttacgcttgatccttcaaaacgggattttagcaatgtccaagatttg
ctggatgatcctatctatcgctttcaacatcgtttctttccgattattgctattctaatg
ggttttggattgccaatggccattggcgcgctttggggcgacccgctcagcgctcttgtg
attgctggcgctttaaggattacggtggtttatcagatgacgttttttattaattcactt
tgtcatatgattggcaaacaaacttacaaaaattcatctgctcgggataattgggtaacc
gccctgcttactatgggcgaaggttttcataattttcaccatcaatttccgattgattat
cgaaacggcgtgcgcttttttcactttgatccaacgaaatggttgatttatttgttatcc
cggatgggattggtgtctagcttaaagcgcgtagagcaacgcagaatcattaaataccgt
ctgcaaaccgatactcaacgtttggcactgctttcagcagaaagagtagaggtcgtaaaa
ccgctttatgagcgcattcatcacttgttagggcggctggaagaacttgaaaagagttat
ttagcattgaaagaggcgcaatttaaggcttataaaaaccgactccgagaaatacgacaa
aagctaaaagcaacggagcgcgagcttcgaactttcttaactctgtggagcaaggtggcc
cggccgcttcagacttgtcaacttagtggatcataa

DBGET integrated database retrieval system