KEGG   Coxiella burnetii CbuG_Q212: CbuG_1152Help
Entry
CbuG_1152         CDS       T00787                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
cbg00040  Pentose and glucuronate interconversions
cbg00052  Galactose metabolism
cbg00500  Starch and sucrose metabolism
cbg00520  Amino sugar and nucleotide sugar metabolism
cbg01100  Metabolic pathways
cbg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CbuG_1152 (galU)
   00052 Galactose metabolism
    CbuG_1152 (galU)
   00500 Starch and sucrose metabolism
    CbuG_1152 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CbuG_1152 (galU)
Enzymes [BR:cbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CbuG_1152 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACJ18486
Position
complement(1108495..1109382)
Genome map
AA seq 295 aa AA seqDB search
MKKVTTAVFPVAGLGTRFLPVTKAGPKEMLPIVDKPIIQYVVEEAIAAGITHLVFVTSSS
KRAIEDYFDSNYELETRLRSSRKLDALKLIQNLLPKEVRISYVRQAHPLGLGDAVLSAKH
VVGDQPFAVLLPDDIIDCGEKSCLQLMMEAFEKHQRNIIAVEQVPLNQTDKYGIVSVVDE
HQVKRITGMVEKPPLGSALSDWAVTGRYILSPRVFDHLDAISCGVGGEIQLTDAIVALLQ
EEQVLAFPFKGHRYDCGSRLGFLQATIAYALKRPEFKEPLREYLFKLLGSECVGG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtcactactgccgtttttcctgtggccggattgggaacacgattcctgccg
gtaaccaaagcggggcccaaagaaatgttgccgattgttgataagccaattattcaatat
gtagtagaagaggcgatcgctgccggcattacgcatctcgtttttgtaacgagcagcagc
aagcgggctatcgaagattattttgatagtaattatgaattggaaacgcggttgcgctcc
agtaggaaactggatgccttgaaattaatacagaatctcttacccaaagaagttcgtatt
agctatgtgcgtcaagcgcaccctttaggcttgggtgatgcggtattatcggcgaaacat
gtcgtcggcgaccagccgtttgcggtattgttacccgatgacattattgactgcggtgag
aaaagctgtttgcaattgatgatggaagcttttgaaaagcatcaacggaatatcattgcg
gttgaacaggtgcctttaaatcaaaccgataaatatggcatcgtttctgtggtggatgag
caccaggtgaagcgaattactggtatggttgaaaaacctcccctcggaagcgcgttgtca
gattgggctgtcaccggccgctatattttgtctccacgtgtttttgatcatttggatgcc
atcagttgtggcgtggggggggagattcaactaacggatgcgattgtcgcgctgttgcaa
gaagagcaggtgcttgcctttcccttcaagggtcaccgttacgattgcgggagtcgattg
ggtttcttgcaggcgacgattgcttatgcgctcaaacggcctgaatttaaagagcccttg
cgggaatatttatttaaactgttgggctcggagtgcgtggggggttaa

DBGET integrated database retrieval system