KEGG   Coxiella burnetii CbuG_Q212: CbuG_1170Help
Entry
CbuG_1170         CDS       T00787                                 

Gene name
asnB2
Definition
asparagine synthetase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CbuG_1170 (asnB2)
Enzymes [BR:cbg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CbuG_1170 (asnB2)
Peptidases [BR:cbg01002]
 Cysteine Peptidases
  Family C44
   CbuG_1170 (asnB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1130106..1132004)
Genome map
AA seq 632 aa AA seqDB search
MCGIAGIFNLNGKPVAFDQIKAMTDSIAHRGPDGEGQFTDKYIGLGHRRLAIIDLSPAGH
QPMQTKDGRYLITYNGEVYNFKILRKELETLGYSFFSNTDTEVVLNAYVQWGEKCLEKFN
GMFAFAVWDRKEKTLFLARDRYGIKPLYYYQTNDCFVFASEIKAIIASGLYGAEINKEAL
VEYLTFQNFFTDRTLFKDVRIMPAGHFMMVKRENSSLHQYWDFNFTNDSALSEKMLLEKI
NDLFQQAVNRQLVSDVPVNSYLSGGVDSGSITMIAAKQLPHIRTFTVGFDLSSASGLELA
FDERQAAEHLSYLAGTEHYEMVLKAGDMERCMQDLVWHLEEPRIGQSYPNFYAAKLASKF
GKVVLAGTGGDELYAGYQWRYLCGQSSENFEDYIDKYYQYWQRLMSNKNLFKVLAPIAEE
VKSIWTRDIFANVFRIKDTPIKTEDYINYSLYFEAKTFLHGLLVVEDKLSMAHGLETRVP
CLDNDFVDFALQVPVKYKLSDFAFERVNENDTFSKREKRMNGKKILRKMMSRYVPDNVAH
APKQGFSAPDASWFKGESIEFVRSLLGDRNAKIFELLDYSVVNHLVNDHIQNHHNHRLLI
WSLIYLEIFMQVHLSKGHKSNYHLFTPETVEL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggtattgcaggcattttcaatttaaatggtaagccagttgctttcgatcaaatt
aaagcgatgacggattctattgctcatcgcggaccggatggcgagggacagtttactgac
aaatatatcggattgggacatagaagactggcgattatagatttaagtcccgcagggcat
caaccgatgcaaacgaaggatggtcgttatcttattacttataatggtgaagtttataat
ttcaaaatactgcgtaaagagttagaaactttgggctattcatttttttctaataccgat
acggaagtggttttaaacgcttatgtacaatggggagaaaagtgtttagaaaaatttaat
ggcatgtttgcttttgccgtttgggatcgcaaagaaaaaacattatttttagccagagac
cgttatggaattaaaccattatattattatcaaacaaacgattgcttcgtttttgcctct
gaaataaaggcgattattgcttcaggtctttatggcgctgagattaataaagaggctttg
gtagaatatttaactttccaaaatttctttacggatcgaacgctttttaaagatgtccgc
attatgcctgccggtcattttatgatggtaaaaagagaaaattcatctcttcatcaatat
tgggattttaattttacaaatgattcagcgctttctgaaaaaatgctattagaaaaaatt
aatgatttgtttcagcaagcggttaaccgccagcttgtcagtgatgttcctgtgaatagt
tatttaagcgggggggtggactcgggatcgattacaatgattgcagcaaaacaattgccg
cacatacgtactttcacagtagggttcgatttgagttccgcttctggtttggaattagca
tttgacgagcgtcaagcagccgaacatctttcctatcttgctggcactgagcattatgaa
atggtattaaaagcgggagatatggagcgttgcatgcaggatttggtgtggcatttggaa
gaaccgcggatcggacaaagttatccaaatttttacgcggctaaattggccagtaaattc
ggtaaagttgtattagctggaactggcggagacgagctttacgcaggataccaatggcgc
tatttgtgcggacagagtagcgaaaattttgaagattatattgataaatattatcaatat
tggcagcggttgatgagtaacaaaaatctttttaaagttcttgctcctattgctgaagaa
gtaaaatctatttggactcgagatatatttgctaatgtttttcgaattaaggatacgcca
ataaagactgaagactatattaattattctttatattttgaagccaaaacatttttgcat
ggattgctcgtagttgaagacaaactaagtatggcgcacggacttgaaactcgggtacct
tgtcttgacaatgatttcgttgattttgctttacaggtgcctgtgaaatataagctatct
gatttcgcgtttgaaagggtcaatgaaaacgacacattctctaaacgagaaaaaaggatg
aatggtaaaaaaatcttacgtaaaatgatgagtcgctatgtgcccgataacgtcgctcat
gctccgaagcaaggattctcggcaccggatgccagttggttcaaaggagaaagtatcgaa
tttgtgcgctcgttgcttggtgatagaaatgctaaaattttcgaattactcgattattca
gtcgtgaaccatttggtgaatgaccacattcaaaaccatcacaatcaccgattattaatt
tggtcactaatttatttagaaatttttatgcaggttcatttgtctaagggtcataaatct
aattatcatttgtttacgccagaaacggtggagctttaa

DBGET integrated database retrieval system