KEGG   Coxiella burnetii CbuG_Q212: CbuG_1205Help
Entry
CbuG_1205         CDS       T00787                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1167871..1168437
Genome map
AA seq 188 aa AA seqDB search
MENIMSNTIADHVKAILIALGEDPNREGLRDTPKRYEKALEHLTKGYHEKLPSVVKKAVF
QSGMDEMVILKDIELYSLCEHHLLPFIGRCHVAYLPSGKIIGISKLARIVDMFAKRLQVQ
ENLTKQIAEAILTATEAKGVGVIIEAKHLCMMMRGVEKQNSEMTTSVMLGTFRKDDRTRS
EFLSLIRK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaatattatgagcaatactattgcagaccatgttaaagcgatattaatcgcgtta
ggagaagacccgaaccgagaaggcttaagggatacacctaaacgctatgaaaaagccttg
gaacacctcaccaaaggctatcatgaaaagcttccatcggttgtcaaaaaggcggtattc
caatccggaatggacgagatggtcatcctcaaggatattgagctttactcgctctgcgag
catcatttattgcctttcattggcagatgtcacgtcgcctacctccccagcggaaaaatt
attggcatctcaaagctggctcgcattgtcgatatgttcgccaagcgcttgcaagtacaa
gaaaatctcaccaaacaaatcgcagaagccatattaaccgcgacggaagcaaaaggtgtc
ggcgttatcattgaagcaaaacacctttgcatgatgatgcgcggcgttgaaaaacaaaat
tcagaaatgaccacttcggtcatgctcggcaccttccgaaaagacgaccgcacccgctca
gaatttttgagtttaattagaaagtaa

DBGET integrated database retrieval system