KEGG   Coxiella burnetii CbuG_Q212: CbuG_1282Help
Entry
CbuG_1282         CDS       T00787                                 

Gene name
sepB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CbuG_1282 (sepB)
Enzymes [BR:cbg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CbuG_1282 (sepB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1243740..1244621
Genome map
AA seq 293 aa AA seqDB search
MKCLPPEKAFLGLEPQKAVPYEKAKAVIIPFGLERSVSYGGGTAQGPAAMIEASFEVELF
DEALWCEPYCDIGIVTLEEPKIEADMQSALKQLETLVQQVLDDEKFPFVFGGEHSITAGS
IRPFVNAYDNLAILHFDAHADLRDGYEGEHYSHASAIRRCLDYPSVEVISVGIRNISAEE
IPFFEANRNRIHIYWAKDKKTWDINEIIAPLKNRPIYLTFDLDGFDASLMPATGTPEPGG
LFWNDAQEIITAAGQVGTIVGADINELAPIPGFHSCDFLAAKLAYKILSSAFK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcctccctcctgaaaaagcctttttaggactcgaaccgcaaaaggctgtccct
tatgaaaaagccaaagcggtgatcattccttttgggcttgaacgttcggtcagctatggg
ggagggacggcacaagggccggcggcaatgattgaagcgtcttttgaagtggaattattt
gatgaagcgctttggtgcgaaccttattgcgatatcggcatcgtgacgttggaagaacct
aaaatcgaagctgatatgcaaagcgcattgaaacaactggaaacgttagtgcaacaggta
ttagatgacgaaaaattccccttcgtttttggaggcgagcattccataacggcgggttct
attcgcccatttgtgaacgcctatgataacttagcgattttacattttgatgctcatgca
gatttgcgcgatggttatgaaggcgagcattattcgcacgcctctgctattagacgctgt
ttggactatcctagtgtggaagtcatttcagtgggtattcgaaatatttcagcggaagaa
attcccttttttgaagccaaccgcaatcgcattcatatttattgggcgaaagataaaaaa
acttgggatattaatgaaatcattgcgcctttaaaaaatcgccctatttatctgactttc
gatcttgacggttttgatgcaagcttaatgcctgccactgggacccccgaacctggcggc
cttttttggaatgacgctcaagaaattattactgcggccggtcaagtgggcactattgta
ggcgctgatattaatgaattagcacctatccctggattccacagttgcgattttttagcc
gcaaaattagcttacaaaattctttcatccgccttcaaatag

DBGET integrated database retrieval system