KEGG   Coxiella burnetii CbuG_Q212: CbuG_1301Help
Entry
CbuG_1301         CDS       T00787                                 

Gene name
cysQ2
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7 3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CbuG_1301 (cysQ2)
Enzymes [BR:cbg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CbuG_1301 (cysQ2)
Transfer RNA biogenesis [BR:cbg03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CbuG_1301 (cysQ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1259625..1260458
Genome map
AA seq 277 aa AA seqDB search
MIKMEAFIYSEKMLTSVIEIIKFAAKKILSIYSEPTSLVVTKKGDGSPLTKADQLAHDFI
SAQLTNLTPKIPIISEELDFEIYSNTLINSYFWLVDPLDGTKDFIKRNGEFTVNIALIKD
SKVVLGVVFVPVTNTCYYANKVVGAFKQVGEQPPQQLQLTPQNKARDLNQPIKVAISRHH
GLDGIQKFIDKIGPCECVSMGSSLKICSLAEGEVDIYPRLGPTKEWDTAAAQCVLEQAGG
KILIETGKSLFYNKLDFLNPKFLALGSRGNPAWVTYL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgattaagatggaagccttcatttatagtgaaaagatgttgacatctgtgatcgaaata
atcaagtttgctgcaaaaaagattcttagtatctatagtgaacccacttctttagtagtg
acaaagaaaggcgatggttccccgttaacaaaagctgatcaattggcacatgattttatt
tcagcgcaactcactaatttaaccccgaagattcccatcatttccgaagagttagatttt
gagatttattctaacacccttataaattcttatttttggttggttgatcctttagacggg
accaaagactttattaaacgcaatggcgaatttactgttaatatagccttaatcaaagat
tcgaaagtagtactcggggtagtgtttgttcctgtaaccaacacttgttattatgcaaat
aaagtagttggcgccttcaagcaagttggagaacaaccaccccaacaattacaattgacc
ccgcagaacaaagcaagggatttgaatcaacctatcaaagtcgcaataagtcgccaccat
ggacttgatggcatacaaaaatttattgataaaattggtccttgcgagtgtgtcagcatg
ggcagtagcttgaagatatgctcgttagcagaaggggaagtagacatctacccgagatta
ggtcctacgaaagagtgggatacggctgcagcgcaatgcgttttagaacaagcgggcgga
aaaattctgattgaaaccggaaaatcattattttacaataaattggattttttaaatcca
aaattcttggctcttggtagtaggggaaatccagcttgggttacctatttataa

DBGET integrated database retrieval system