KEGG   Coxiella burnetii CbuG_Q212: CbuG_1422Help
Entry
CbuG_1422         CDS       T00787                                 

Gene name
yfcX
Definition
3-hydroxyacyl-CoA dehydrogenase (EC:4.2.1.17 5.3.3.8 1.1.1.35 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbuG_1422 (yfcX)
   01212 Fatty acid metabolism
    CbuG_1422 (yfcX)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CbuG_1422 (yfcX)
   00650 Butanoate metabolism
    CbuG_1422 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    CbuG_1422 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    CbuG_1422 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CbuG_1422 (yfcX)
   00310 Lysine degradation
    CbuG_1422 (yfcX)
   00380 Tryptophan metabolism
    CbuG_1422 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CbuG_1422 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CbuG_1422 (yfcX)
   00281 Geraniol degradation
    CbuG_1422 (yfcX)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CbuG_1422 (yfcX)
Enzymes [BR:cbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CbuG_1422 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CbuG_1422 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CbuG_1422 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1380684..1382612)
Genome map
AA seq 642 aa AA seqDB search
MNREVFTEFNKVLDEIAAQNPIAVILQSGKKKGFIAGADIKQFTDLKNKNEAFDLIRQAQ
LVLDKLEALPMPTVAMISGFCLGGGLEVALACRYRVAEDNESTLIGLPEVKLGIHPGWGG
TVRLPKLIGAPKAMEIMLPGAAVPARKAAKLGMVDAAVPLRNLENAARYFALQKPPVHKP
KGWEKYTNVSYIRPWLGRLFYKKLSAKVEKTHYPAPYAIVHNWIKEGVGKEAYFTEAQSI
AQLMMTESSRNMVRLFFLRERLKSLAKKTRYLPQQIHVIGAGVMGGDIAAWCALRGIRVT
LHDKSAEKIAPAIKRAHALYEKKLKIPRLIQAAMDRLEPDVEGTGVKKADLIIEAVFEDI
KVKQEVLSAIEPQLKPEAILATNTSSLSLDELSSVLKNPERLVAIHFFNPVAKLPLVEVA
SSQQTSADIAEKALAFVGAIDKLPLAVSSSPGFLVNRALMAYLLEANRCLDEGFSMEQID
KAATDFGMPIGPIELADRIGLDICLSVAQHLKNFYKHAEVSERLKTLVKEGHLGAKTGQG
FYHYQNGRRVESKSTAESTNPDLTDRLILQLVNEVKKCLDEKVIDKEDLADAGIVFGTGF
APFRGGPMQYAKSRGEADVVKTLKRLAKQYGERFLPSEGWSA
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgggaagtttttactgaatttaataaagtgctcgatgaaattgctgctcaaaat
cccatagccgttatccttcaatcaggaaagaaaaaaggattcatcgccggtgcagacatc
aaacaatttaccgatttaaaaaacaaaaatgaagcctttgatttaatccgccaagcgcag
ctcgtccttgataagctcgaagcgctgcccatgccaaccgtagcgatgattagcggattt
tgtttaggcggcggtttggaagtggcgcttgcctgtcgctatcgagtggcggaagataat
gaatccacgctgattggattacccgaagtgaaattgggtattcatccagggtggggtggt
accgttcgattgcctaaattaatcggcgcgccgaaagcaatggaaattatgctgccaggt
gcagcagttccggcgagaaaagctgctaagcttgggatggttgacgccgcagtaccgctt
cgtaatttagaaaatgccgctcgttatttcgctttgcaaaagccccccgtccataaaccg
aaaggatgggaaaaatacacgaatgtaagttatattcgcccgtggttagggcggttattt
tataaaaaactctctgcaaaagtggaaaaaacgcattacccggcgccatacgccatcgtc
cataattggatcaaagagggggttggcaaagaagcctacttcacagaagctcagtcgatc
gcgcaattaatgatgaccgagagcagtcgcaacatggtgcgactgttttttttaagagaa
cgcttgaagtcgctcgctaaaaaaacgcgctatctgccgcaacaaattcacgttattggc
gctggtgtgatgggcggcgatattgcagcttggtgtgcgcttcgcggcatccgcgtgact
ttacacgataaatcagcggaaaaaattgcgccagcgataaagcgggcgcatgctctttat
gaaaaaaaattaaaaatcccgcgcttaattcaggcagcgatggaccgattagagccggat
gtggaaggaacgggcgttaaaaaagcggatttaattattgaagctgtttttgaggatata
aaagtaaagcaggaagttttaagtgctatcgaaccgcaattaaaacccgaggctatttta
gcgactaacacgtccagtctttctttagatgaattaagttcggtgttaaaaaaccctgag
cgcttagtggctattcattttttcaatcccgttgctaaattaccgttggttgaagtggca
agcagtcagcagacatcggcggacattgctgaaaaagcgttagcgttcgtgggagctatt
gataaattgccgttggcggtgagcagcagtccaggatttttagtcaatcgggcattaatg
gcttatttattagaagcgaaccgttgtttagacgaagggttttccatggaacaaattgat
aaagcggcaactgattttgggatgcccataggtccgatcgagctagctgatcggattggg
ttagacatatgtttgtctgttgctcaacatctgaaaaacttttacaagcatgccgaagtt
tcagaacgattaaaaacattggttaaggaaggtcatctaggcgctaaaacgggtcaaggg
ttttatcattatcaaaacggaagacgtgttgaatcaaagtctacagccgaatcaacgaat
cctgatttaaccgaccggttaatattgcaactcgttaatgaagtcaagaaatgtttggat
gagaaagtgattgacaaggaagatttagccgatgcagggatcgtatttggcacggggttt
gcaccgtttcggggtggaccgatgcagtatgccaagagtcgtggagaggccgatgtcgtg
aaaactttaaaacgcttagcaaaacaatacggtgaacgatttttgcctagcgaaggatgg
tccgcatga

DBGET integrated database retrieval system