KEGG   Coxiella burnetii CbuG_Q212: CbuG_1498Help
Entry
CbuG_1498         CDS       T00787                                 

Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbuG_1498
   01230 Biosynthesis of amino acids
    CbuG_1498
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuG_1498
   00030 Pentose phosphate pathway
    CbuG_1498
   00051 Fructose and mannose metabolism
    CbuG_1498
  Energy metabolism
   00680 Methane metabolism
    CbuG_1498
Enzymes [BR:cbg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CbuG_1498
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     CbuG_1498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1466378..1467526)
Genome map
AA seq 382 aa AA seqDB search
MEITLSAIKADVGSIGGHTQPSIEMLQAVQQSLQKNIDSGLLIDGLVTFTGDDIAIICSH
QQGLNNEDVHVGFAWQAFLAATEVAKKQGNYGAGQDLLVDAPSGNFRGAGPGVAEIEFTL
NPKSNYRPAESFMIFAGDKCAPGAFNLPLYLVFCDPMHNGGILLNPKIHLGWVFTVIDMD
YKGEDEDRIIQLSVPERSWDVAALLQNPDRYAVESIRSRYKPEEQVVSVSATRLHNIAGK
YTGKDDPIAIIRSQGIFPAPEEIIEPYSTINQIISGDARGSHNMPQLPVPINTPVTGPYC
HPLISALGFSMNKQGKFSGRYVDFFAGSAWDYARYVSQRRAAEIRRQGFMGIAMAQEAEI
AYTGLVDTWKKLDDEFELRKNG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaccttaagcgctattaaagccgatgtgggcagtatcggcggtcacacccaa
cctagcattgaaatgctacaggctgttcagcaatcccttcaaaagaatatcgactccgga
ttattgatcgatggattggtaactttcactggcgatgatattgcgattatttgttcacat
caacagggtttaaataatgaagacgttcatgtcggttttgcgtggcaagcttttcttgca
gcaactgaagtggcgaaaaagcaaggcaattacggcgctggccaggatttactcgtggat
gcgccttctggcaattttcgaggcgctggacctggtgttgctgaaattgaatttaccctt
aatccaaaatccaattaccgtccggctgaatcctttatgatatttgcaggtgataagtgc
gcacccggcgcatttaatcttcctctttatttagttttttgtgatccgatgcataatggg
ggaattttattaaatccaaaaatacatttaggctgggtgtttacggtgattgatatggat
tacaaaggggaagacgaagatcgtattattcagctttctgttcccgaacgctcctgggac
gttgccgcgttgttgcaaaatcccgatcggtatgcggttgaatccattcgctcacgttat
aaacctgaagaacaagtggtttctgtttctgccacgcgattgcataacattgcaggaaaa
tacacaggcaaggatgatccaattgctattattcgcagtcaaggtatttttccggcacct
gaggaaattattgagccgtattcgactattaatcaaattatcagcggcgatgcgcgcggc
tctcataacatgccgcaattaccggttcctattaatacgcctgttactggaccgtattgt
catcccctaatttcggcacttggtttttccatgaataagcagggtaaattttctggacgt
tatgtggatttttttgcgggttctgcttgggattacgcgcgttatgtttcccagcgtcga
gcggccgaaattaggcggcaaggatttatgggcatcgctatggcgcaggaagcagaaatt
gcctacactggattagtagatacgtggaaaaaactggatgacgaatttgaattgcgaaaa
aatggataa

DBGET integrated database retrieval system