KEGG   Coxiella burnetii CbuG_Q212: CbuG_1664Help
Entry
CbuG_1664         CDS       T00787                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:cbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbuG_1664 (pfkA)
   01230 Biosynthesis of amino acids
    CbuG_1664 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbuG_1664 (pfkA)
   00030 Pentose phosphate pathway
    CbuG_1664 (pfkA)
   00051 Fructose and mannose metabolism
    CbuG_1664 (pfkA)
   00052 Galactose metabolism
    CbuG_1664 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CbuG_1664 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CbuG_1664 (pfkA)
Enzymes [BR:cbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CbuG_1664 (pfkA)
Protein phosphatases and associated proteins [BR:cbg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CbuG_1664 (pfkA)
Messenger RNA biogenesis [BR:cbg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CbuG_1664 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1612313..1613311
Genome map
AA seq 332 aa AA seqDB search
MQLGANVTEIKKLIVLTSGGDAPGMNAAIRAVVRTALHYQFEVYGATAGFAGLVNGQVVP
LNSRAVANCIQRGGTILKTGRFENFRFKAVRDKAREFLKKLQIDAMIVLGGNGSFAGASK
LYQEGGPQMIGIPCTIDNDIQGTDYCIGFDTACNTALQAIDKIRDTAFSHERNFLIEVMG
RSSGFIAVNVGIAGGAEIIALPEFHVDIDTLTQKIKKQHGKKSASIIVAAEANQPGHSFE
VAKQIKEKTGIEYRVCVLGHTQRGGTPTVKDRVLASLMGAQAIEALKKGLTEKMIAYQNG
KIAVAPLPDPDNGTRYFADEALLRVNNIICAM
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaggagccaacgtgaccgaaataaaaaaattaatagtgcttacttctggaggc
gatgcacctggcatgaatgctgcaatccgtgctgttgtgcgaacagcgctccattatcaa
tttgaagtttacggtgccacagccggttttgctggtttagttaacgggcaggtcgttcct
ctcaattcgcgcgcggttgccaattgcatccagcgtggcggtacaattttaaaaacgggg
cgtttcgaaaattttcgtttcaaagcagtccgtgacaaagcgcgggaatttttaaaaaaa
ttgcaaatcgatgccatgatcgttctcggcggcaacggcagttttgcgggcgcttcaaaa
ctgtaccaagaaggcggacctcaaatgattgggattccatgcactatcgataacgacatt
caaggaacggattattgcattggttttgatacggcttgtaatacagctttgcaagctatc
gataaaattcgcgatacggcattcagccacgagcgaaattttttaattgaggttatgggg
cggtcttccggttttatcgcggtgaatgtcggcatcgctggcggtgcggaaatcattgcg
ctacctgaatttcacgtcgatattgatacattgacgcaaaaaattaaaaaacaacacggt
aaaaaatcagcctccattattgtcgctgctgaagccaatcaacccggccacagctttgaa
gtcgccaaacaaataaaagaaaaaaccggcatcgaataccgcgtctgcgtcctcggccac
acccaacgcggcggaaccccaacggtaaaagatcgcgtgcttgcttctctgatgggagca
caggccattgaagcactaaaaaaaggattaaccgaaaagatgatcgcttatcaaaatggt
aaaatagctgttgcgcccctgccggatcccgacaacggaacgcgatattttgctgatgag
gccttgttaagggttaataatattatttgcgccatgtga

DBGET integrated database retrieval system