KEGG   Coxiella burnetii CbuG_Q212: CbuG_2078Help
Entry
CbuG_2078         CDS       T00787                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cbg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1992231..1993037
Genome map
AA seq 268 aa AA seqDB search
MENESLKNKTIMITRPEGQGELLKKAIERRGGAVILFPTLIIKPINKCNYSPFASASFPP
SRESGSPDDKMTKAGFLNSSDILIFLSANAVKHSPILNFKAEQKLVAIGTGTAAALFQRG
LSVDAVPEHFSSEGLLDLPLLHQVTGKTIAIFCGENSRPYLGNELIHRGANVFSIITYRR
EKPVVNKKTIDALTHQTLHAIVSTSAESLQNLCTLFESHQHWLHRIPLVVISKRMENLAK
SQGFHLVLLADNPGEKAIIKVLSTKYPS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgaatccttaaaaaataaaaccatcatgatcactcgccctgaagggcaggga
gaattattaaaaaaagccattgaacgtaggggcggcgccgttattttatttccaaccctt
attataaaaccaattaataaatgcaactactcgcccttcgcatccgcaagttttccacct
tcccgcgaaagcgggagtccggatgataaaatgactaaggctggatttctgaattcaagc
gacatcctcatttttctaagtgcaaatgctgtaaaacattctcctattttaaattttaaa
gcggaacaaaaattagttgctattggcacaggtaccgccgcggctttatttcaacgcgga
ctttctgttgatgccgttcccgaacatttcagtagtgaaggccttttagatttgccttta
ctccatcaggtgactggaaaaacaattgctattttttgcggcgaaaactctcgcccttat
ttaggaaacgaacttatccatcgcggcgcaaatgtattctccattattacttaccgacga
gaaaaacctgtcgtcaataaaaaaacgattgacgcactcactcaccaaacgcttcatgca
attgtctccactagcgccgaaagcctccaaaatctctgcaccttattcgaatcacaccaa
cactggttacaccgtatcccgctcgttgtcattagcaaaagaatggaaaacttagcaaaa
tctcaagggttccacttggtgcttctagcagacaatcctggagaaaaggctattataaag
gttttatccactaaatatccgagttaa

DBGET integrated database retrieval system