KEGG   Coxiella burnetii CbuG_Q212: CbuG_2097Help
Entry
CbuG_2097         CDS       T00787                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cbg  Coxiella burnetii CbuG_Q212
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cbg00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cbg00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2007856..2008788
Genome map
AA seq 310 aa AA seqDB search
MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVANLFFEPSTRTR
NSFEIAAKRLGAMVLNPNLKISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAK
QLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCVTIIGDIRHSRVANSLMDGLV
TMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF
RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLE
LFLLRDFRFF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacttcctttacatttattgaatatgcgctcactcacgcgcgaccatattgaa
aaactcatccaacgggcgaattattttttaactcagggcatggaaaaaaattcggtcttt
gaaacattaaaagggcacgtagtcgccaacttattttttgaacccagcacacgaacgcgc
aactcctttgaaattgcggcaaaacgtttgggcgccatggttcttaaccctaatcttaaa
atttcggcaataagtaaaggtgaaactctttttgatacgattaaaactttggaagcgatg
ggtgtttattttttcattgtacgccattctgaaaatgaaaccccggagcagatagcaaaa
caattatcctcaggcgtcgtcatcaacgcgggtgacggtaatcaccaacatccctcacaa
gctttaattgatttaatgacaataaagcaacacaaaccccattggaataaattgtgcgtc
acgattattggcgatattcgtcattctcgcgtggcaaactcattaatggacggcttagtc
acgatgggcgttccggaaattcgattggtaggcccatcgtcattattgccggacaaggtc
gggaacgactcgattaaaaaattcaccgaattaaaaccaagtctccttaacagcgacgtt
attgtcacccttcgtttgcaaaaggaacgccatgataattctgtcgatatcgatgctttt
cgcggatcttttcgattgacacctgaaaaattatattccgcaaaacccgatgccattgtt
atgcatccgggtcccgtcaaccgcgaagtcgaaattaattctgatgtcgcagataaccaa
caatctgtcatccttcaacaagtacgtaacggcgtcgctatgcggatggctgtgttggaa
ttatttttgttgcgagattttcgatttttttga

DBGET integrated database retrieval system