KEGG   Clostridium botulinum A Hall: CLC_0053Help
Entry
CLC_0053          CDS       T00575                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cbh  Clostridium botulinum A Hall
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cbh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
40174..40770
Genome map
AA seq 198 aa AA seqDB search
MDFYPIAIEKLIEEFAKLPGIGYKTAQRLTLYVLNLPKEEVKEFSEALVKARGTIKYCSV
CGNFTDKDPCAICSNPNRNKSIICVIEQPKDIMSMEKIREYNGVYHVLHGNISPMAGRGP
EDIKLKELIRRIDGSVNEVIVATNPNVEGEATAMYISKILKPLGVKVTRIAHGVPVGGDL
EYADEVTLAKALEGRIEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttggatttttatcctatagctatagaaaaattaatagaagagttcgctaaattaccgggt
ataggttataaaacagctcaaagacttactctatatgtactaaatttacctaaagaagag
gtaaaggaattctcagaggccttagtaaaagctagaggtacaattaaatattgttctgta
tgtggtaattttacagataaagatccttgtgctatatgtagtaatcctaataggaataaa
tctattatttgtgtaatagaacaacctaaagatataatgtctatggaaaaaataagagaa
tataatggagtatatcatgtattacatgggaatatatctcctatggcaggaagaggtcct
gaagacataaaattaaaagaattaataagaagaatagatggtagtgtaaatgaagttata
gttgctactaatcctaatgtagaaggagaagcaacagctatgtatatatctaaaatatta
aaacctctaggagttaaagttacaagaattgcccacggagtaccagtaggtggggattta
gaatatgcagatgaggttactttagctaaagctttagaaggaagaatagaattataa

DBGET integrated database retrieval system