KEGG   Clostridium botulinum A Hall: CLC_0284Help
Entry
CLC_0284          CDS       T00575                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00010  Glycolysis / Gluconeogenesis
cbh00051  Fructose and mannose metabolism
cbh00562  Inositol phosphate metabolism
cbh01100  Metabolic pathways
cbh01110  Biosynthesis of secondary metabolites
cbh01120  Microbial metabolism in diverse environments
cbh01130  Biosynthesis of antibiotics
cbh01200  Carbon metabolism
cbh01230  Biosynthesis of amino acids
Module
cbh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLC_0284 (tpiA)
   00051 Fructose and mannose metabolism
    CLC_0284 (tpiA)
   00562 Inositol phosphate metabolism
    CLC_0284 (tpiA)
Enzymes [BR:cbh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLC_0284 (tpiA)
Exosome [BR:cbh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLC_0284 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLC_0284 (tpiA)
  Exosomal proteins of melanoma cells
   CLC_0284 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5400030
NCBI-ProteinID: YP_001386184
Position
262741..263487
Genome map
AA seq 248 aa AA seqDB search
MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKV
GAQNMHFEESGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNL
IPIVCCGESLEEREGNITEKVLEGQIKVGLKELSKEQVEKLVIAYEPIWAIGTGKTATDE
QANETIGYIRTVVKAMYGESVADKIRIQYGGSVKPGTIKAQMAKEEIDGALVGGASLKAE
DFAAIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagctataatagcaggaaactggaagatgaacaaaactgtaaaagaagcagta
gaattggttaaagaattaaaaccacttgttaaagatgcaaaatgtgatgtagttgtatgt
cctacttatgtatgccttccagcggtattagaagaagttaaaggaagcaatataaaagta
ggtgctcaaaatatgcactttgaagaaagtggagcttacacaggtgaaatagcacctaaa
atgttagaagaactaggagttcattatgtaattataggacatagtgaaagaagacaatac
tttaatgaaacagatgaaactgtaaataaaaaagtaaaaaaagccttcgaacataactta
attccaatagtttgttgtggagaaagcttagaagaaagagaaggaaatataacagaaaaa
gttttagaaggacaaataaaagttggattaaaggaattaagtaaagaacaagtagaaaaa
ttagttatagcatatgaaccaatttgggctataggaacaggaaaaactgccacagatgag
caagcaaatgaaactataggatatataagaactgtagtaaaagctatgtatggtgagagc
gttgcagataaaataagaattcaatacggtggatctgttaagcctggcactatcaaagct
caaatggctaaagaagagattgatggtgcattagtaggtggtgcaagcttaaaagcagaa
gattttgcggctatagtaaattattaa

DBGET integrated database retrieval system