KEGG   Clostridium botulinum A Hall: CLC_0284Help
Entry
CLC_0284          CDS       T00575                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbh  Clostridium botulinum A Hall
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLC_0284 (tpiA)
   01230 Biosynthesis of amino acids
    CLC_0284 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLC_0284 (tpiA)
   00051 Fructose and mannose metabolism
    CLC_0284 (tpiA)
   00562 Inositol phosphate metabolism
    CLC_0284 (tpiA)
Enzymes [BR:cbh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLC_0284 (tpiA)
Exosome [BR:cbh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLC_0284 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLC_0284 (tpiA)
  Exosomal proteins of melanoma cells
   CLC_0284 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
262741..263487
Genome map
AA seq 248 aa AA seqDB search
MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKV
GAQNMHFEESGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNL
IPIVCCGESLEEREGNITEKVLEGQIKVGLKELSKEQVEKLVIAYEPIWAIGTGKTATDE
QANETIGYIRTVVKAMYGESVADKIRIQYGGSVKPGTIKAQMAKEEIDGALVGGASLKAE
DFAAIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagctataatagcaggaaactggaagatgaacaaaactgtaaaagaagcagta
gaattggttaaagaattaaaaccacttgttaaagatgcaaaatgtgatgtagttgtatgt
cctacttatgtatgccttccagcggtattagaagaagttaaaggaagcaatataaaagta
ggtgctcaaaatatgcactttgaagaaagtggagcttacacaggtgaaatagcacctaaa
atgttagaagaactaggagttcattatgtaattataggacatagtgaaagaagacaatac
tttaatgaaacagatgaaactgtaaataaaaaagtaaaaaaagccttcgaacataactta
attccaatagtttgttgtggagaaagcttagaagaaagagaaggaaatataacagaaaaa
gttttagaaggacaaataaaagttggattaaaggaattaagtaaagaacaagtagaaaaa
ttagttatagcatatgaaccaatttgggctataggaacaggaaaaactgccacagatgag
caagcaaatgaaactataggatatataagaactgtagtaaaagctatgtatggtgagagc
gttgcagataaaataagaattcaatacggtggatctgttaagcctggcactatcaaagct
caaatggctaaagaagagattgatggtgcattagtaggtggtgcaagcttaaaagcagaa
gattttgcggctatagtaaattattaa

DBGET integrated database retrieval system