KEGG   Clostridium botulinum A Hall: CLC_0589Help
Entry
CLC_0589          CDS       T00575                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00010  Glycolysis / Gluconeogenesis
cbh00030  Pentose phosphate pathway
cbh00051  Fructose and mannose metabolism
cbh00680  Methane metabolism
cbh01100  Metabolic pathways
cbh01110  Biosynthesis of secondary metabolites
cbh01120  Microbial metabolism in diverse environments
cbh01130  Biosynthesis of antibiotics
cbh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLC_0589
   00030 Pentose phosphate pathway
    CLC_0589
   00051 Fructose and mannose metabolism
    CLC_0589
  Energy metabolism
   00680 Methane metabolism
    CLC_0589
Enzymes [BR:cbh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CLC_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-GeneID: 5399140
NCBI-ProteinID: YP_001386472
UniProt: A5HZ60
Position
complement(604348..606354)
Genome map
AA seq 668 aa AA seqDB search
MTLYDENNLHIIKDNLRYLKLLSKQYPSISSASSEIINLQAILNLPKGTEHFISDVHGEY
ESFTHMLKNASGVIKRKIDDVFGTSLRECDKKNLATLIYYPEQKLDLIKKSEKNLEDWYK
ITLYRLIRLCQIVSSKYTRSKVRKSLPSDFAYIIEELLNEQGDRVDKQEYYNSIIETIID
IDRASEFIIAISNVIQRLVVDKLHIIGDIYDRGPGAEIIIEALSKHHSIDIQWGNHDIVW
MGAAAGCEACIANVIRISLRYANLSTLEDGYGINLLPLATFAMDFYKEDNCENFKPRTID
KNLNETDIKLLSKMHKAISIIQFKLEGKIIKRRPEFKMGERLLLDKINIKEGTLNLNEKI
YKLIDTNFPTLDKENPYELNERERDLVEKLTNSFINSEKLQRHIKFLYSNGNLYLKYNSN
LLYHGCIPLNEDGSLKEVTLCKETLKGKSLLDKLDRLAREAYFFKKDPESKLYGMDMMWY
LWCGSNSPLFGKKKMTTFERYFLDDKNTHKEQKNPYYKYRNDEKMCTMIFEEFELDADNS
HIINGHIPVKTKEGENPIKANGKLLVIDGGFCKAYQPQTGIAGYTLIYNSYGLLLTSHEP
FSSIHKAIVEGNDILSSTTILEHVSSRKRVLDTDSGEEIKKQIHDLEMLLVAYRKGLIKE
ENEANIRF
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgactttatatgatgagaacaacttacatataataaaagataatttaagatatttaaaa
ttattgtccaaacagtatcctagtatttcaagtgctagttcagaaattataaatcttcaa
gcaatattaaacctccctaagggaacagaacattttataagtgatgttcacggagagtat
gaatcttttactcatatgctaaaaaatgcatcaggagttattaaaagaaaaatagatgat
gtctttggaacttctttaagggaatgtgacaaaaaaaatttagctacactaatatactat
cctgaacaaaaattagatttaataaaaaaatctgaaaaaaacttagaagattggtacaaa
ataactttatatagattaataagactatgccaaatagtttcttctaaatatactagatct
aaagttagaaaatctctaccttctgattttgcttacattattgaagaattattaaatgaa
caaggtgatagagtagataagcaagaatattacaacagtataattgaaactattatagat
attgatagagcttctgaatttataattgctatatcaaatgttattcaaagattagtagta
gataagcttcatataataggagatatctatgatagaggtcctggagctgaaattataatc
gaagctttaagtaagcatcattctatagatatacaatggggtaatcatgacattgtatgg
atgggagctgctgcgggatgtgaagcttgtattgccaatgtaataagaatatctcttcgt
tatgctaatttatccacattagaagatggatatggtataaatttattaccattagctact
tttgctatggatttttataaagaagataattgtgaaaattttaaaccgagaactatagat
aaaaatttaaacgaaacagatattaaacttttatcaaaaatgcataaagctatatcaata
attcaatttaagttggaaggtaaaataatcaaaagaagacctgaatttaaaatgggagaa
agattattattagataaaataaatataaaagaaggtactttgaacctaaacgagaaaatt
tataaattaattgatactaactttcctacattagataaagaaaatccttatgaattaaat
gaacgagaacgagatttagtagaaaaacttacaaattcgtttattaatagtgaaaagtta
caaagacatataaaatttttgtatagtaatggaaatctttacctaaagtacaactctaat
ttactatatcatggttgtatacctttaaatgaggatggctccttaaaagaagtaactcta
tgcaaggaaaccttaaagggtaaatcccttctagacaaactagatcgtttagcaagagaa
gcttacttttttaagaaagatccagaatcaaaactatatggtatggacatgatgtggtat
ttatggtgtggttctaactctcctttatttggtaaaaaaaagatgaccacctttgaaaga
tatttcttagatgataagaatacacataaagaacaaaaaaatccttattataaatataga
aatgatgaaaaaatgtgcacaatgatatttgaagaatttgaactagatgctgataattcg
catataataaatggtcatattcctgtgaaaactaaagaaggcgaaaatcctataaaagct
aatggtaaactattagttatagatggtggtttttgtaaagcctatcagccacaaacgggt
attgcaggatatacattaatatataattcctatggattacttctaacctctcatgagccc
tttagttctatacacaaagctatagtagaaggaaatgatatactttcatctactacaata
ttagaacatgtatcctcacgaaaaagagtattagatacagatagtggtgaggagataaaa
aaacagatacatgatttagaaatgctattagttgcttacagaaaaggtcttataaaggaa
gaaaatgaagcaaatataagattttag

DBGET integrated database retrieval system