KEGG   Clostridium botulinum A Hall: CLC_0883Help
Entry
CLC_0883          CDS       T00575                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cbh  Clostridium botulinum A Hall
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CLC_0883 (folP)
Enzymes [BR:cbh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CLC_0883 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
909075..910271
Genome map
AA seq 398 aa AA seqDB search
MFKIIIELNKNSFPEEFNKIEVHEGSMNIFMNKNNITPLKIFNVLAPAANIIKQEILALG
GDCAVNKYCINCKVETSDIILLGTKRQYKKLLQKLKCMTFFRIEEIVGELENYIKNNGAV
KTVLKDEREINYENLKVMGIINCTPDSFYEGSRKDSTEEALKTAEKMLKEGAEILDIGGE
STRPGSDPVDEEEEIKRVVPVIREIKNKFKDVIISIDTYRANTAKSAIEAGADIVNDISA
MKYDENMVKVVKEYNVPVILMHVKGKPKDMQIDPVYENLMKEIHLYFNERIEYCKSHGIT
EDKIILDPGIGFGKTVEHNLKIMNRIEELKSFNLPVLLAASRKATIGKVLGNLPTEERLE
GTIALSCLAVDVGIQMVRVHDVKENIRAIRMLEAVRKI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaaaataattatagaattaaataaaaatagtttcccagaagagttcaataagata
gaagtacatgagggtagtatgaatatatttatgaataaaaataatattacccctttaaaa
atttttaatgtgctagctcctgcagccaatataataaagcaagaaatactggctttaggt
ggagattgtgctgtaaataaatattgtataaattgcaaagtggaaacttcagatataatt
ttattaggaaccaaaagacagtacaaaaaattattgcaaaagcttaaatgcatgactttt
tttagaatagaagaaatagtaggggaattagaaaactatattaaaaataatggagctgtt
aaaacagttctaaaggatgaaagagaaataaactatgaaaatttaaaggttatgggaatt
ataaattgtactccagattctttttatgagggttctagaaaagattctacagaagaagcc
ttaaaaactgcagaaaagatgttaaaagaaggtgcagaaattttagatataggcggagaa
tccacaagaccaggttctgacccagtagatgaagaggaagaaataaaaagagtagttcct
gttataagagagataaagaataaatttaaggatgtcataatttccatagatacttataga
gcaaatacggcaaagtctgccatagaggcaggtgcagacatagtaaatgatataagtgct
atgaagtatgatgaaaatatggtgaaagtagttaaagaatacaatgtacctgtaatactt
atgcatgtaaaaggaaaaccaaaggatatgcaaatagatccagtttatgagaatttaatg
aaagaaattcatctttattttaatgagagaatagagtactgcaaatctcatggtataaca
gaggataaaataatattagatccaggcataggttttggaaaaactgtagagcataatcta
aaaataatgaatagaatagaagaattaaaaagctttaatcttccagtacttttagcagcc
tcaagaaaagctaccataggaaaagttttaggaaacttacctacagaagaaagattagaa
ggaaccatagctttatcctgtttagcggtagatgtaggaattcagatggtgagggtacac
gatgtaaaagaaaatataagagccataagaatgttagaggcagtaagaaaaatataa

DBGET integrated database retrieval system