KEGG   Clostridium botulinum A Hall: CLC_0885Help
Entry
CLC_0885          CDS       T00575                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cbh  Clostridium botulinum A Hall
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
910754..911209
Genome map
AA seq 151 aa AA seqDB search
MHTVYVAFGSNIGEKESYIKRALEKIEERGMEIIKVSSIYETEPYGVLDQDSFLNGVVKI
ETNLTPEDLIGELLNIEKQLNRVRERRWGPRTIDLDIIFYDDLIINEKDLVIPHKDMENR
EFVLKPLCDIDENFIHPVLKKSVRELYDELK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgcatacagtttatgtggcctttgggagtaatataggtgaaaaagaaagttacataaaa
agggcattggaaaagatagaagaaagaggaatggaaataattaaagtatcctctatatat
gaaacagaaccctatggagtattagatcaagatagttttttaaatggagtagtaaaaata
gaaactaatttaactccagaagatttaataggggagcttttaaacatagaaaaacagtta
aatagagtaagagaaagaagatggggacctagaactatagatttagatattattttttat
gatgatttaataataaatgaaaaagatttagttattcctcataaggatatggaaaacaga
gagtttgtattaaagcctttgtgtgatatagatgaaaattttatacatccggttttaaaa
aaatcagtaagagaattgtatgatgagttgaagtaa

DBGET integrated database retrieval system