KEGG   Clostridium botulinum A Hall: CLC_0935Help
Entry
CLC_0935          CDS       T00575                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbh  Clostridium botulinum A Hall
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLC_0935
Enzymes [BR:cbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CLC_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
959089..960510
Genome map
AA seq 473 aa AA seqDB search
MSGLAKDFLWGGATAANQCEGGYLEGNRGLGTVDVIPAGVNRRAVMQGKMHYNNLQEDSY
FPSHEAIDMYHNYKEDIALFAEMGFKCYRFSLSWSRIFPTGKEQEPNEEGLAFYEKFIDE
LLKYNIEPVVTICHFDVPLVLEQEYGSWRSRKLIDAYLRYCEAIFKRFNGKVKYWITFNE
INMLMHLPFMGAGIMFKEGENELEVKYQAAHNELVASALATKLAKEINKDNKVGCMLAAG
QFYPYTCKPEDVLEAMEKDKNNYFFIDVQSRGEYPSYAKKFLERNNIKIEMQSEDEKILR
ENTVDFIAFSYYTSRLASSDPNAGEKSAGNVITSLKNPHLKSSKWGWQIDPIGLRITMNS
LYDRYQKPLFIVENGLGAVDILNEDGTVDDDYRIAYLETHIKNMIDAVELDGVELLGYTT
WGCIDLVSASTGEMKKRYGFIYVDKDNDGHGTLKRYKKKSFYWYKNVIKNNGL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattagcaaaggatttcttgtggggcggagctacggcagctaaccaatgcgaa
ggtggttatttagaaggaaataggggattaggaactgtggatgttattccagcaggagta
aatcgtagagctgttatgcaaggaaagatgcattataataatttacaagaggattcttat
ttcccatcacatgaagcaatagatatgtatcataactacaaggaggatatagcattattt
gcagaaatgggatttaaatgttatcgtttctcactttcatggtcaagaattttcccaaca
ggaaaggaacaagaaccaaatgaagaaggcttagcattttatgaaaaatttattgatgag
ctattaaaatataatattgaaccagtagttaccatatgccattttgatgtacctcttgta
ttggagcaggaatatggttcatggagaagtagaaaattaatagatgcatatcttagatat
tgtgaagcaatatttaaaagatttaatgggaaagtaaagtattggataacttttaatgaa
ataaatatgcttatgcatttaccctttatgggagctggaataatgtttaaggaaggggaa
aatgagctagaagtaaaatatcaagcagctcataatgaattagtggcatcagccttagct
acaaaattagcaaaggaaattaataaagataataaagtaggatgtatgttagcggcaggg
caattctatccatatacttgtaagccagaagatgttctagaagctatggagaaagataaa
aataattatttcttcatagatgtacaatctaggggagaatacccgagctatgctaaaaaa
ttcttagagagaaacaatataaaaatagaaatgcagtcagaagatgagaagattttaagg
gagaatactgttgattttattgcatttagttactatacttcaagacttgcaagtagtgac
ccgaatgcaggagaaaaatcagctggtaatgtaataacatcattaaaaaatccacattta
aaatctagtaaatggggatggcaaatagatccaataggccttagaattacaatgaattca
ctttatgatcgttatcaaaaaccgctattcattgtggaaaatggcttaggtgctgttgat
attttaaatgaggatgggactgtagatgatgattatagaattgcttatcttgaaactcat
ataaaaaatatgattgatgcagttgaattagatggtgttgaactattaggatatacaact
tggggatgcattgatttagttagtgcatcaacaggggaaatgaaaaagcgatatggtttt
atatatgtagataaggataatgatggtcatggaactttaaagagatacaagaaaaaatct
ttctattggtacaaaaatgttattaaaaataatggactataa

DBGET integrated database retrieval system