KEGG   Clostridium botulinum A Hall: CLC_0976Help
Entry
CLC_0976          CDS       T00575                                 

Gene name
cobA_hemD
Definition
uroporphyrinogen III synthase/methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cbh  Clostridium botulinum A Hall
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLC_0976 (cobA_hemD)
Enzymes [BR:cbh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CLC_0976 (cobA_hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CLC_0976 (cobA_hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1000526..1001986
Genome map
AA seq 486 aa AA seqDB search
MSKVYLIGAGPGDEELITLKAIRALKKCTAVMYDRLANGELLKYLAPNCEIYYCGKEPGC
HYKSQDEINKMLVKLAKEGHIVGRIKGGDPYVFGRGGEEALDILEENIEFEVIPGVTSPV
SVLNYAGIPITHRGISRGFHIFTAMTKDKLDIDWKSVVNIGGTLVFLMGLGRLELITKGL
IENGMDKEGKVAVVMKGTTSKQKKVIGNLENIVEKVKEAKLESPVIIVVGEVVSFSDKLN
WYEKKPLFGRNICITRTKEQAKELKVQLLDLGAEVTEINSIEIKNTEDNLKSYLSKLKEY
DYIALTSVNAVKIFFDYLIKENIDIRNINAKFAAIGPATSEAIRIRGIMPSIKSKHFVAE
SLFEEMRKHIQKGDKILVPRSKDARPFLVDALRKEGCTVDEVHIYGTLCGQCTYTERFED
ADTVLFTSPSTVRNMISMVGIDSIKEKSIIAIGPITAAELDKNNIECSICDEYSINGIID
KLLDLN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtatatttaattggtgcagggccaggtgatgaagaattaataactttaaaa
gccataagagccctaaaaaaatgtactgcagttatgtatgatagattagcaaatggagaa
ttgttaaaatatttagcaccaaattgtgaaatttattattgtggaaaagaaccgggctgt
cattataaaagccaggatgaaataaataaaatgctagttaaattagcaaaagaaggtcat
attgtaggaagaataaaaggtggagatccctatgtatttggaagagggggagaagaagcc
ttggatattttagaagaaaatatagaatttgaagttataccaggtgtaacttctccagta
tctgtactgaattatgcaggaattcctataacccatagaggaatatcaagagggtttcat
atttttacagctatgactaaggataaattagatatagattggaagtctgtagttaatata
ggaggaaccttagtatttttaatggggcttggaagattagaattaataactaaaggtctt
atagaaaatggaatggacaaagaaggtaaagtagcagtggttatgaaaggaactacctca
aagcaaaaaaaagttataggtaacttagaaaatatagtagaaaaagtaaaagaagctaaa
ctagagtcaccagtaataatagtagtaggagaagtagttagtttttcagataaattaaat
tggtatgaaaaaaagcctttattcggaagaaatatatgcataacccgtacaaaagagcaa
gctaaggaattaaaagttcaacttttagatttaggggctgaagttacagaaataaattct
atagaaataaaaaatacagaagataatttaaagtcttatttaagtaaattaaaggaatat
gattatatagctttaaccagtgtaaatgcagttaaaatattttttgattatttaattaaa
gaaaatatagatattagaaatattaatgctaaatttgcagctataggaccagctactagt
gaggcaataaggataagaggaataatgccaagcattaagtcaaagcattttgtagcagag
agtctttttgaagaaatgagaaagcatatacaaaagggagataaaatacttgtgcctcgt
tctaaagatgcaagaccatttcttgtggatgcattaagaaaagaaggttgtactgtggat
gaagtacatatatatggaaccctatgtggacaatgtacatatactgaaagatttgaagat
gcagatacagtattatttacaagtccatctactgttagaaatatgatttctatggtgggc
atagatagtataaaagaaaaaagtattatagcaataggtcctattacagcagcagaatta
gataaaaataatatagaatgtagtatttgtgatgaatattctataaatggcataatagat
aaacttttagaccttaactag

DBGET integrated database retrieval system