KEGG   Clostridium botulinum A Hall: CLC_1183Help
Entry
CLC_1183          CDS       T00575                                 

Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cbh  Clostridium botulinum A Hall
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cbh00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1221883..1222443
Genome map
AA seq 186 aa AA seqDB search
MFKSILIIDCQNDFISGSLACDNGEIAVKNIINLLNINKDLKVFYSLDWHSENNKSFKIN
GGIWPVHCVVNRFGAKLEESFYKELQHKNHSPNNKKILFSKGKNDHIEEYSAYEGENILG
NKINEVLDKDVIVCGIASEFCVKETVEDLIRNGFNVELYIDGVAYVNKKEHEKTLNNLRE
QGAKFI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtcaatacttataatagactgccaaaatgatttcatatcaggttcactggct
tgtgataatggagagatagctgttaaaaacattataaatttattaaatataaataaagat
ttaaaagtattttactctttagattggcatagtgaaaataataaatcttttaaaataaat
ggtggtatatggccagtacattgtgtagtcaatagatttggtgctaaactagaggagagt
ttttataaagaattacaacataaaaatcattcacctaataataaaaaaatattgttttca
aaaggaaaaaatgatcatatagaagaatattcagcctatgaaggagaaaatattttaggt
aataagattaatgaagtattagataaggatgtaattgtatgtggtatagcttctgagttt
tgtgttaaagaaacggtagaggacttaattagaaatggatttaatgtggaattatatata
gatggggtagcatatgtaaataaaaaagaacatgaaaaaactttaaataatttaagagag
cagggggctaaatttatttaa

DBGET integrated database retrieval system