KEGG   Clostridium botulinum A Hall: CLC_1242Help
Entry
CLC_1242          CDS       T00575                                 

Definition
(RefSeq) O-glycosyl hydrolase, family protein
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cbh  Clostridium botulinum A Hall
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CLC_1242
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CLC_1242
Enzymes [BR:cbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CLC_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1287668..1288996
Genome map
AA seq 442 aa AA seqDB search
MKFIQYKTTKKDKFLKNEINNTTDERPTLHVSQIENRIIEGFGSCFNELGMKALNHLDKD
ERNKVLDQLFSTKGDCRFNLCRMPIGASDYATEWYSYNENENDFDMEKFSIQKDKRLLIP
YIKEALKRNPNIILTASPWSPPTWMKTQKAYNFGTLRFEEKVLKAYALYFVKFVQAYEEE
GITIHQVHVQNEVVADQKFPSCRWTGDQLTDFIKNYLGPAFEKHNISSEIWLGTINAPEP
YVEWLEDYTQDFDVYAGLVLRDTKAYKYVKGVGYQWAGKNAIQRSVEAFAEKRFIQTENE
CGNGKNTWIYAEYVFNLFRHYIVNGVNGYMYWNAVLEPKGMSTWGWEQNSMITVNPETKE
VMYNPEFYVMKHFSHFVQKGAKRLTTSGVDSVDTVAFRNPDESIIIVISNKNDDSRIANI
EFTGEIFEVELEGHSFNTIVLE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatacagtataaaactactaaaaaagataaattcttaaaaaacgaaattaat
aatactacagatgaaagaccaacattacatgtttcacaaattgaaaataggatcatagag
ggatttggaagttgttttaatgagctggggatgaaagcattaaatcacttagacaaagat
gaaagaaataaagtacttgatcaactattttctactaaaggtgattgtcgttttaatctt
tgcagaatgcctattggagcaagtgattatgcaacagaatggtatagctataacgaaaat
gaaaacgattttgatatggagaaatttagtattcaaaaagataaaagacttcttatacct
tatataaaagaagcattaaaaagaaatcctaatataattctaacagcttctccatggagt
cctccaacttggatgaaaacacagaaggcttacaattttgggactctacgctttgaagag
aaagttttaaaagcatatgctctttatttcgttaaatttgtacaagcatatgaggaagaa
ggaataacaattcatcaagttcatgttcagaatgaagttgttgcagatcaaaaatttccg
tcttgtagatggacaggagatcaattaacggattttattaaaaattatttaggaccagcc
tttgaaaagcataatattagcagtgaaatttggttagggacaattaatgcgccagagccc
tatgttgaatggctagaagattatacacaagattttgatgtttatgctggcttagtattg
agagatacaaaagcatataagtatgttaaaggagtaggatatcaatgggcaggaaaaaat
gctattcagcgttcagttgaagcatttgcagaaaaaagatttatccaaactgaaaatgag
tgcggtaatggtaaaaatacatggatatatgcagaatatgtttttaatctattcagacat
tatattgtaaatggtgtaaatggatatatgtattggaatgctgttttagaaccaaaagga
atgagtacttggggatgggaacagaattctatgataactgtaaatccagaaactaaagaa
gttatgtataatccagagttctatgtaatgaaacatttttctcattttgttcaaaaaggg
gcaaaaagattaactacttcaggtgtagattctgttgatacagtagctttcaggaatcca
gatgaatctataattattgtaatttcaaataaaaatgatgattctagaattgctaatatt
gaatttacaggtgaaatatttgaagttgaattagaaggacattcatttaacactattgtt
ttagaataa

DBGET integrated database retrieval system