KEGG   Clostridium botulinum A Hall: CLC_1308Help
Entry
CLC_1308          CDS       T00575                                 

Definition
(RefSeq) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00051  Fructose and mannose metabolism
cbh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CLC_1308
Enzymes [BR:cbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CLC_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 5398911
NCBI-ProteinID: YP_001387174
UniProt: A5I1A8
Position
1355107..1355754
Genome map
AA seq 215 aa AA seqDB search
MNNETYLRLQIVEVGKRLQQRFFVASNDGNISAKLDENTILITPTGVNKGEVTPDQIIKV
DREGNVIEGHMKVTSEIKMHLAVYNMREDVKAIVHAHPPASTAFSVSKEKLDDPVILPEA
VFSLGKIGYCEYGTPSTDEVPKAIEKEIPYSDVLLLSNHGALTVGTDVMQAYYRMENLEM
VSKVTIYSKMIGNIKTLNELQVEKLNKVKEEKGWG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgaataatgaaacgtatttaaggttacaaattgtagaggtaggaaaaagacttcaacaa
agattttttgtagcttcaaatgatggaaatataagtgctaaacttgatgaaaatactata
ttgattacgcctacaggggttaataaaggagaagtaaccccagatcaaataataaaagta
gatagagaaggaaatgttatagaaggtcatatgaaggttacatctgaaataaaaatgcat
ttagctgtttataatatgagagaagatgtaaaagctatagttcatgcccatccaccagca
tccacagctttttcagtatcaaaagaaaaactagatgatcctgttattcttccagaagca
gttttttcattagggaaaataggatattgtgaatatggaactccttctactgatgaggtt
ccaaaagctatagaaaaagaaattccatatagtgatgtacttttattatctaaccatgga
gctcttacagtaggtacagatgtaatgcaggcttattacagaatggaaaatttagaaatg
gtttcaaaggtaactatttattcaaaaatgataggaaatataaaaactttaaatgaacta
caagttgagaaattaaataaagtaaaagaagaaaaaggttgggggtaa

DBGET integrated database retrieval system