KEGG   Clostridium botulinum A Hall: CLC_1631Help
Entry
CLC_1631          CDS       T00575                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00010  Glycolysis / Gluconeogenesis
cbh00052  Galactose metabolism
cbh00500  Starch and sucrose metabolism
cbh00520  Amino sugar and nucleotide sugar metabolism
cbh00521  Streptomycin biosynthesis
cbh01100  Metabolic pathways
cbh01110  Biosynthesis of secondary metabolites
cbh01120  Microbial metabolism in diverse environments
cbh01130  Biosynthesis of antibiotics
cbh01200  Carbon metabolism
Module
cbh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLC_1631
   00052 Galactose metabolism
    CLC_1631
   00500 Starch and sucrose metabolism
    CLC_1631
   00520 Amino sugar and nucleotide sugar metabolism
    CLC_1631
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLC_1631
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CLC_1631
Enzymes [BR:cbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLC_1631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N IF2_N DUF460
Motif
Other DBs
NCBI-GeneID: 5400381
NCBI-ProteinID: YP_001387490
Position
1706875..1707822
Genome map
AA seq 315 aa AA seqDB search
MNKKYVVGVDLGGTKIYTALVDLDGNIIKEKNVKTEASKGELDVLYKIINTIDNVIEGVN
LEEIKAIGIGSPGPLDAKEGIIISSSNLPFENFSLVQPIKDKYNIPTYLDNDANVATLAE
FMFGKGKGTQNMIYVTASTGIGAGAIINSRIYRGNTGNALEIGHTTVMKDGPNCGCGNKG
CAESLGSGTAIMKKAKEVCKNNGETSLKKYDNLTAKEVFEEAKKGDKLSKEVLEFCLSYL
GITVANIINTFDPEMVVIGGGVINGGEIVCDIINREVKNRCWKAIRDNCKITKAKLAGKA
GVLGAAALAITESKN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaatatgtagtgggtgttgatttagggggaacaaagatttatacagcactt
gtggatttagatggaaatataataaaagaaaaaaatgttaaaactgaagcaagcaaagga
gaacttgatgtattatataaaataataaatactattgataatgttatagaaggagtaaac
ttagaggaaataaaggctataggaataggttcaccaggacctttagatgctaaagaaggt
ataataatttcatcttcaaatctaccctttgaaaattttagcttagttcaacctataaag
gataaatataatattccaacatacctagacaatgatgctaatgtagctactttagctgaa
tttatgtttggtaaaggaaaaggtacccagaacatgatatacgtaacagcaagtacaggc
attggagcaggagctataataaatagcagaatatatagaggaaatacaggaaatgcttta
gaaataggtcatacaactgttatgaaggatggaccgaactgtggttgtggtaataagggt
tgcgcagaaagtttaggttctggtactgccattatgaaaaaggcaaaagaagtttgtaaa
aataatggagagacatctttaaaaaaatatgataatctaactgcaaaggaagtttttgaa
gaagctaaaaaaggagataagctttcaaaagaagtactagaattttgcttatcctattta
ggtataactgtagccaatataataaatacttttgatccagaaatggttgttataggcgga
ggagttataaatggtggagaaattgtttgtgatataataaatagagaagtgaaaaataga
tgctggaaagctattagagataattgtaaaataacaaaagcaaagcttgcaggaaaagca
ggggttctaggagctgcagccttagctataactgaaagtaaaaattaa

DBGET integrated database retrieval system