KEGG   Clostridium botulinum A Hall: CLC_1688Help
Entry
CLC_1688          CDS       T00575                                 

Definition
(RefSeq) hypothetical protein
Organism
cbh  Clostridium botulinum A Hall
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF975 ECSCR DUF4013
Motif
Other DBs
NCBI-GeneID: 5400390
NCBI-ProteinID: YP_001387544
UniProt: A5I2D1
Position
1777328..1778161
Genome map
AA seq 277 aa AA seqDB search
MEEKTILSNSQIKSKAKEALKGNWGTAVIAFIIFNIVMYCVNYVYNINQISNYIHDPYLV
RENAGFGASGILFFIKLLLAGPMTYGITKFSMNLVRDKSHKIENIFEGFKHFSGTFIMNI
VLGIYSFLWSLLLFIPFFAIVFVMVIREFSKTNMNFYSTGNDFSGWMIAIFILLIIVLTV
ALSMILFRYAMTYYIYIDNPDMGAMEAIKESVSMMKGNKTRLLLLYLSFILWYLLGIVTV
GIAFLWITPYIKSTEAVFYDELKKSNEHNAHEAISAL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaagacgatattatctaattcccaaataaaatctaaagctaaagaagcctta
aaggggaattggggtacagcagttattgcattcattatatttaatatagtaatgtattgt
gtaaactatgtatataatataaatcaaatttcaaattatatacatgatccttatctagtt
agggagaatgcaggcttcggagcatctggtattctattttttataaaattacttttagca
ggtcctatgacctatggaataacaaaattctctatgaatttagttagagataaaagtcat
aaaatagaaaatatatttgaaggttttaaacattttagtggaactttcattatgaatata
gttctaggtatatacagttttttatggtcattgttgctttttatacctttttttgcgatt
gtttttgttatggtaattagagaattttcaaaaactaatatgaatttttatagtacaggt
aatgattttagtggatggatgatagcaatttttatacttttaattatagttttaactgtg
gccttatcaatgattttatttagatatgctatgacttattatatctatattgataatcca
gatatgggagctatggaagctattaaagaaagtgtttctatgatgaaaggaaacaagaca
agattacttttactatatttaagctttatattgtggtatttattggggattgtaactgta
ggtattgcatttttatggataactccttatataaaatctactgaagctgttttttatgat
gagttaaagaagagtaatgagcataatgcccatgaagcaataagtgcattataa

DBGET integrated database retrieval system